DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32301 and Gyc32E

DIOPT Version :9

Sequence 1:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster
Sequence 2:NP_001097148.1 Gene:Gyc32E / 34553 FlyBaseID:FBgn0010197 Length:1191 Species:Drosophila melanogaster


Alignment Length:297 Identity:78/297 - (26%)
Similarity:131/297 - (44%) Gaps:68/297 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   785 EGYLNYILKASYFMSMCFEKKHELTKVKTRTIKIIMANILPTHVAEVFKVRRRSDQLYYENFSQV 849
            :..|:.:.|.:|.:....:::..|...:.:...:::..:||..|||:.|   |.|.:..|.|..|
  Fly   839 DNMLSIMEKYAYNLEGLVQERTNLLYEEKKKTDMLLYQMLPRPVAELLK---RGDPVEAECFDCV 900

  Fly   850 AVMFATIENY------EADKSGLRALHEMICYFDELLVNYQSWYKIEKIKVMGWTYLAACGLHVD 908
            .::|:.|..:      ......:..|::.....|.::.||.. ||:|.|   |..|:...||   
  Fly   901 TILFSDIVGFTELCTTSTPFEVVEMLNDWYTCCDSIISNYDV-YKVETI---GDAYMVVSGL--- 958

  Fly   909 HYTDFSVSVPISTNRESDKLQKSGSVRFAPMDGDEIMIKDLHPTQATTNEDDNTILVMTEFALNL 973
                     |:          ::|| |.|   |:                       :...||:|
  Fly   959 ---------PL----------QNGS-RHA---GE-----------------------IASLALHL 977

  Fly   974 LRILRDIRSKGIFFEKDSKLTGSLKIGIAHGPVMAGVVGLSKPHYDIWGHTVNMASRMTSTGVRD 1038
            |..:.:::.:    .|.:: |..|:||:..||..|||||...|.|.::|.|||.||||.|||...
  Fly   978 LETVGNLKIR----HKPTE-TVQLRIGVHSGPCAAGVVGQKMPRYCLFGDTVNTASRMESTGDSM 1037

  Fly  1039 GIHVTESTANVLRDF-NIRCTYRGMTFVKGVGQVPTY 1074
            .||::|:|..:|:.. :..|..||:|.:||.|.:.||
  Fly  1038 RIHISEATYQLLQVIGSYVCIERGLTSIKGKGDMRTY 1074

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850
CYCc 812..1051 CDD:214485 64/244 (26%)
Nucleotidyl_cyc_III 841..1076 CDD:299850 66/241 (27%)
Gyc32ENP_001097148.1 PBP1_Speract_GC_like 44..448 CDD:107365
ANF_receptor 59..427 CDD:279440
PHA02988 534..826 CDD:165291
PK_GC-A_B 550..832 CDD:270944
HNOBA <847..886 CDD:285003 8/38 (21%)
CYCc 865..1057 CDD:214485 65/252 (26%)
Guanylate_cyc 892..1076 CDD:278633 66/241 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453886
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.