DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32301 and GUCY2D

DIOPT Version :9

Sequence 1:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster
Sequence 2:NP_000171.1 Gene:GUCY2D / 3000 HGNCID:4689 Length:1103 Species:Homo sapiens


Alignment Length:374 Identity:86/374 - (22%)
Similarity:164/374 - (43%) Gaps:92/374 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 PYFAVMLLTPSILMPSREPNVEQYESIAILVSCLMALLLTAMDLILPI--CYFRPFSLVPSYDHV 145
            || |::.|||       |..|::..|...|...|:::....::.||.:  |:.....|.||.||.
Human   745 PY-AMLELTP-------EEVVQRVRSPPPLCRPLVSMDQAPVECILLMKQCWAEQPELRPSMDHT 801

  Fly   146 VIVLIYLMFPIAFVKNGRAYFLGLAVSLFYFGYMALIDKISTLDKVWELTAYGAYLFFLNMLCMF 210
                 :.:|  ..:..||                    |.:.:|.:            |.||..:
Human   802 -----FDLF--KNINKGR--------------------KTNIIDSM------------LRMLEQY 827

  Fly   211 LSRFQEYNMRSGILSRYQVVYQNLVFQMAMKEEKA--LLDSIIPVTLARSLQDAIASHIEEDPSN 273
            .|     |:...|..|.:        ::.::::|.  ||..::|.::|.:|:....         
Human   828 SS-----NLEDLIRERTE--------ELELEKQKTDRLLTQMLPPSVAEALKTGTP--------- 870

  Fly   274 LMPFTKTRHLFMEPH--PEVSILEADMVDFTGLTTTMEVSDLVAILHELFVSFDLAANHNRATRI 336
                       :||.  .:|::..:|:|.||.::...|..::|.:|::|:..||.....:...::
Human   871 -----------VEPEYFEQVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGSHDVYKV 924

  Fly   337 KFLGDSYTCVTGIPS-YFPTHANACVNQALDMIEISREVSKRRNKKID--LRIGVHSGEILAGII 398
            :.:||:|...:|:|. ....||....|.:||::........|...::.  :|||:|||..:||::
Human   925 ETIGDAYMVASGLPQRNGQRHAAEIANMSLDILSAVGTFRMRHMPEVPVRIRIGLHSGPCVAGVV 989

  Fly   399 GLTKWQFDIWSKDVDITNRLESSGLPGMVHISSRTLGL---LDNHYVYE 444
            |||..::.::...|:..:|:||:|||..:|::..|:|:   ||:.|..|
Human   990 GLTMPRYCLFGDTVNTASRMESTGLPYRIHVNLSTVGILRALDSGYQVE 1038

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 46/163 (28%)
CYCc 812..1051 CDD:214485
Nucleotidyl_cyc_III 841..1076 CDD:299850
GUCY2DNP_000171.1 PBP1_sensory_GC_DEF-like 55..431 CDD:380594
PK_GC-2D 536..811 CDD:270945 20/80 (25%)
HNOBA <820..865 CDD:369471 12/69 (17%)
CYCc 846..1036 CDD:214485 53/209 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1065..1103
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.