DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32301 and GUCY2C

DIOPT Version :9

Sequence 1:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster
Sequence 2:NP_004954.2 Gene:GUCY2C / 2984 HGNCID:4688 Length:1073 Species:Homo sapiens


Alignment Length:282 Identity:77/282 - (27%)
Similarity:133/282 - (47%) Gaps:56/282 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 TLARSLQ--DAIASHIEEDPSN---------------LMPFTKTRHL----FMEP--HPEVSILE 295
            ||.|.||  .....|:.|:.:.               |:|....:.|    |:||  :.||:|..
Human   763 TLIRRLQLYSRNLEHLVEERTQLYKAERDRADRLNFMLLPRLVVKSLKEKGFVEPELYEEVTIYF 827

  Fly   296 ADMVDFTGL---TTTMEVSDLVAILHELFVSFDLAANHNRATRIKFLGDSYTCVTGIPSYFPT-H 356
            :|:|.||.:   :|.|||.|:   |::::.|||...:|:...:::.:||:|...:|:|..... |
Human   828 SDIVGFTTICKYSTPMEVVDM---LNDIYKSFDHIVDHHDVYKVETIGDAYMVASGLPKRNGNRH 889

  Fly   357 ANACVNQALDMIEI--SREVSKRRNKKIDLRIGVHSGEILAGIIGLTKWQFDIWSKDVDITNRLE 419
            |......||:::..  :.|:.......|.:|||||||...||::|:...::.::...|:..:|:|
Human   890 AIDIAKMALEILSFMGTFELEHLPGLPIWIRIGVHSGPCAAGVVGIKMPRYCLFGDTVNTASRME 954

  Fly   420 SSGLPGMVHISSRTLGLL---DNHYVYEEGTDTAKLDPLLQRSNLSTYLIRSRLPNFEDTDDLED 481
            |:|||..:|:|..|:.:|   :..::||...:|.    |..|.|.:||.:..          ::|
Human   955 STGLPLRIHVSGSTIAILKRTECQFLYEVRGETY----LKGRGNETTYWLTG----------MKD 1005

  Fly   482 DNFSL-------NDYRFSFSFS 496
            ..|:|       |..|....||
Human  1006 QKFNLPTPPTVENQQRLQAEFS 1027

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 53/170 (31%)
CYCc 812..1051 CDD:214485
Nucleotidyl_cyc_III 841..1076 CDD:299850
GUCY2CNP_004954.2 PBP1_GC_C_enterotoxin_receptor 35..415 CDD:107364
PK_GC-C 480..750 CDD:270946
Pkinase_Tyr 502..745 CDD:285015
CYCc 788..979 CDD:214485 55/193 (28%)
Guanylate_cyc 815..1002 CDD:278633 59/193 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.