DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32301 and GUCY1B1

DIOPT Version :9

Sequence 1:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster
Sequence 2:XP_011530203.1 Gene:GUCY1B1 / 2983 HGNCID:4687 Length:662 Species:Homo sapiens


Alignment Length:383 Identity:80/383 - (20%)
Similarity:160/383 - (41%) Gaps:89/383 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 GRAYFLGLAVSLFYFGYMALIDKISTLDKVWELTAYGAYLFFLNM------LCMFLSRF-QEYNM 219
            |:..:|..|.|:.:.    ....:..||   :||..|.||..:.:      |.:...:| :||.:
Human   308 GQMIYLPEADSILFL----CSPSVMNLD---DLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKL 365

  Fly   220 RSGILSRYQVVYQNLVFQM-AMKEEKALLDSIIPVTLARSLQDAIASHIEEDPSN---------- 273
            ...:    :::...|...: |:::||...|:..|..:............|:|..:          
Human   366 TQEL----EILTDRLQLTLRALEDEKKKTDTGCPARIQAFKVQTTLMLCEKDSRSTKGFPSISYS 426

  Fly   274 ---LMPFTKTRHLFMEP----------------HPEVSILEADMVDFTGLTTTMEVSD----LVA 315
               |:|..:..:..:.|                :..|:||.:.:|.|....:.....:    :|.
Human   427 GFLLIPLNRLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVN 491

  Fly   316 ILHELFVSFDLAANHNR---ATRIKFLGDSYTCVTGIPSYFPTHANACVNQALDMIEISREVSKR 377
            :|::|:..||...:..:   ..:::.:||.|..|:|:|.....||.:..:.||||:||:.:| :.
Human   492 LLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQV-QV 555

  Fly   378 RNKKIDLRIGVHSGEILAGIIGLTKWQFDIWSKDVDITNRLESSGLPGMVHISSRTLGLLDNHYV 442
            ..:.:.:.||:|:||::.|:||....::.::...|::|:|.|::|..|.:::|..|...|    :
Human   556 DGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCL----M 616

  Fly   443 YEEGTD-------------TAKLDPL----LQRSNLSTYLIRSRLPNFEDTDDLEDDN 483
            ..|.:|             ..|.:|:    |.|.|..|          |:|.  :||:
Human   617 SPENSDPQFHLEHRGPVSMKGKKEPMQVWFLSRKNTGT----------EETK--QDDD 662

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 43/178 (24%)
CYCc 812..1051 CDD:214485
Nucleotidyl_cyc_III 841..1076 CDD:299850
GUCY1B1XP_011530203.1 HNOB 2..166 CDD:311572
HNOBA 207..449 CDD:311573 26/151 (17%)
Guanylate_cyc 455..648 CDD:306677 46/197 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.