DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32301 and GUCY1A1

DIOPT Version :9

Sequence 1:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster
Sequence 2:NP_000847.2 Gene:GUCY1A1 / 2982 HGNCID:4685 Length:690 Species:Homo sapiens


Alignment Length:539 Identity:108/539 - (20%)
Similarity:193/539 - (35%) Gaps:183/539 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 KNIDFLTVLPYFAVMLLTPSILMPSREPNVEQYESIAILVSCLMALLLTAMDL-ILPICYF---- 133
            |..|||.|  |:.....|.|:::|            .|:.:....|..|.::: ::|.|:.    
Human   195 KEDDFLHV--YYFFPKRTTSLILP------------GIIKAAAHVLYETEVEVSLMPPCFHNDCS 245

  Fly   134 ----RPF------------SLVPSYDHVVIV----LIYLMFPIAFV------------------- 159
                :|:            ||.||.....:|    |....||..|:                   
Human   246 EFVNQPYLLYSVHMKSTKPSLSPSKPQSSLVIPTSLFCKTFPFHFMFDKDMTILQFGNGIRRLMN 310

  Fly   160 -------KNGRAYF--LGLAVSLFYFGYMALI------------DKISTLDKVWELTAYGAY--- 200
                   .|...||  |...::..:.|.|.::            :.:....:|.:|.....|   
Human   311 RRDFQGKPNFEEYFEILTPKINQTFSGIMTMLNMQFVVRVRRWDNSVKKSSRVMDLKGQMIYIVE 375

  Fly   201 ---LFFLNMLC-----------MFLSRFQEYN-MRSGILSRYQVVYQNLV-------------FQ 237
               :.||...|           ::||....:| :|..:|...|...|:.:             ..
Human   376 SSAILFLGSPCVDRLEDFTGRGLYLSDIPIHNALRDVVLIGEQARAQDGLKKRLGKLKATLEQAH 440

  Fly   238 MAMKEEKA----LLDSIIPVTLARSL-QDAIASHIEEDPSNLMPFTKTRHLFMEPHPEVSILEAD 297
            .|::|||.    ||.||.|..:|:.| |..:..                   .:....|::|.:|
Human   441 QALEEEKKKTVDLLCSIFPCEVAQQLWQGQVVQ-------------------AKKFSNVTMLFSD 486

  Fly   298 MVDFTGLTTTMEVSDLVAILHELFVSFDLAANHNRATRIKFLGDSYTCVTGIPSYFPTHANACVN 362
            :|.||.:.:......::.:|:.|:..||.........:::.:||:|....|:.....|||.....
Human   487 IVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHKESDTHAVQIAL 551

  Fly   363 QALDMIEISREVSKRRNKKIDLRIGVHSGEILAGIIGLTKWQFDIWSKDVDITNRLESSGLPGMV 427
            .||.|:|:|.||.....:.|.:|||:|||.:.||::|:...::.::..:|.:.|:.||..:|..:
Human   552 MALKMMELSDEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNNVTLANKFESCSVPRKI 616

  Fly   428 HISSRTLGLLDN--------------------------HYV--YEEGTDTAKLDPLLQRSNLSTY 464
            ::|..|..||.:                          |::  |::||::   .|..|:.     
Human   617 NVSPTTYRLLKDCPGFVFTPRSREELPPNFPSEIPGICHFLDAYQQGTNS---KPCFQKK----- 673

  Fly   465 LIRSRLPNFEDTDDLEDDN 483
                         |:||.|
Human   674 -------------DVEDGN 679

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 43/155 (28%)
CYCc 812..1051 CDD:214485
Nucleotidyl_cyc_III 841..1076 CDD:299850
GUCY1A1NP_000847.2 HNOBA 277..466 CDD:400168 33/188 (18%)
Guanylate_cyc 472..643 CDD:306677 43/189 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.