DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32301 and GUCY1A2

DIOPT Version :9

Sequence 1:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster
Sequence 2:NP_001243353.1 Gene:GUCY1A2 / 2977 HGNCID:4684 Length:763 Species:Homo sapiens


Alignment Length:286 Identity:67/286 - (23%)
Similarity:114/286 - (39%) Gaps:90/286 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 AMKEEKA----LLDSIIPVTLARSL---QDAIASHIEEDPSNLMPFTKTRHLFMEPHPEVSILEA 296
            |::|||.    ||.||.|..:|:.|   |...|...:                     :|::|.:
Human   482 ALEEEKKKTVDLLYSIFPGDVAQQLWQGQQVQARKFD---------------------DVTMLFS 525

  Fly   297 DMVDFTGLTTTMEVSDLVAILHELFVSFDLAANHNRATRIKFLGDSYTCVTGIPSYFPTHANACV 361
            |:|.||.:........::::|:||:..||.........:::.:||:|....|:......||....
Human   526 DIVGFTAICAQCTPMQVISMLNELYTRFDHQCGFLDIYKVETIGDAYCVAAGLHRKSLCHAKPIA 590

  Fly   362 NQALDMIEISREVSKRRNKKID-------------------------------LRIGVHSGEILA 395
            ..||.|:|:|.||.....:.|.                               :|||:|||.:||
Human   591 LMALKMMELSEEVLTPDGRPIQPQRSELLFSFPVSIQLVPDQHQSETDLGTEKMRIGIHSGSVLA 655

  Fly   396 GIIGLTKWQFDIWSKDVDITNRLESSGLPGMVHISSRTLGLLDNHYVYEEGTDTAKLDPLLQRSN 460
            |::|:...::.::..:|.:.::.||...|..:::|..|         |:          ||:|..
Human   656 GVVGVRMPRYCLFGNNVTLASKFESGSHPRRINVSPTT---------YQ----------LLKREE 701

  Fly   461 LSTYLIRSR--LPNFEDTDDLEDDNF 484
            ..|::.|||  ||          |||
Human   702 SFTFIPRSREELP----------DNF 717

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 41/186 (22%)
CYCc 812..1051 CDD:214485
Nucleotidyl_cyc_III 841..1076 CDD:299850
GUCY1A2NP_001243353.1 HNOB <159..270 CDD:285002
HNOBA 316..503 CDD:285003 9/20 (45%)
CYCc 485..705 CDD:214485 57/259 (22%)
Guanylate_cyc 514..729 CDD:278633 55/254 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.