DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32301 and Gucy2c

DIOPT Version :9

Sequence 1:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster
Sequence 2:NP_037302.1 Gene:Gucy2c / 25711 RGDID:2771 Length:1072 Species:Rattus norvegicus


Alignment Length:321 Identity:89/321 - (27%)
Similarity:146/321 - (45%) Gaps:71/321 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 TLARSLQ--DAIASHIEEDPSNLMPFTKTR--HL-FM----------------EP--HPEVSILE 295
            ||.|.||  .....|:.|:.:.|....:.|  || ||                ||  :.||:|..
  Rat   762 TLIRRLQLYSRNLEHLVEERTQLYKAERDRADHLNFMLLPRLVVKSLKEKGIVEPELYEEVTIYF 826

  Fly   296 ADMVDFTGL---TTTMEVSDLVAILHELFVSFDLAANHNRATRIKFLGDSYTCVTGIPSYFPT-H 356
            :|:|.||.:   :|.|||.|:   |::::.|||...:|:...:::.:||:|...:|:|..... |
  Rat   827 SDIVGFTTICKYSTPMEVVDM---LNDIYKSFDQIVDHHDVYKVETIGDAYVVASGLPMRNGNRH 888

  Fly   357 ANACVNQALDMIEI--SREVSKRRNKKIDLRIGVHSGEILAGIIGLTKWQFDIWSKDVDITNRLE 419
            |......|||::..  :.|:.......:.:|||||||...||::|:...::.::...|:..:|:|
  Rat   889 AVDISKMALDILSFMGTFELEHLPGLPVWIRIGVHSGPCAAGVVGIKMPRYCLFGDTVNTASRME 953

  Fly   420 SSGLPGMVHISSRTLGLL---DNHYVYEEGTDTAKLDPLLQRSNLSTYLIRSRLPNFEDTDDLED 481
            |:|||..:|:||.|:.:|   |..::||...:|.    |..|...:||.:..          ::|
  Rat   954 STGLPLRIHMSSSTIAILRRTDCQFLYEVRGETY----LKGRGTETTYWLTG----------MKD 1004

  Fly   482 DNFSL-------NDYRFSFSFSQDYEDIQVKAQRDMILEVEHMPVNRVQTCKIRRPMHRIA 535
            ..::|       |..|....||            |||  |..:...:....|.|||. |:|
  Rat  1005 QEYNLPTPPTVENQQRLQTEFS------------DMI--VSALQKRQASGVKSRRPT-RVA 1050

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 55/183 (30%)
CYCc 812..1051 CDD:214485
Nucleotidyl_cyc_III 841..1076 CDD:299850
Gucy2cNP_037302.1 Periplasmic_Binding_Protein_Type_1 34..414 CDD:299141
PKc_like 479..749 CDD:304357
STYKc 501..744 CDD:214568
CYCc 787..978 CDD:214485 58/193 (30%)
Guanylate_cyc 814..1001 CDD:278633 60/193 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.