DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32301 and Gucy1b1

DIOPT Version :9

Sequence 1:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster
Sequence 2:NP_036901.2 Gene:Gucy1b1 / 25202 RGDID:2769 Length:619 Species:Rattus norvegicus


Alignment Length:360 Identity:82/360 - (22%)
Similarity:160/360 - (44%) Gaps:86/360 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 GRAYFLGLAVSLFYFGYMALIDKISTLDKVWELTAYGAYLFFLNM------LCMFLSRF-QEYNM 219
            |:..:|..|.|:.:.    ....:..||   :||..|.||..:.:      |.:...:| :||.:
  Rat   308 GQMIYLPEADSILFL----CSPSVMNLD---DLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKL 365

  Fly   220 RSG---ILSRYQVVYQNLVFQMAMKEEK----ALLDSIIPVTLARSLQDAIASHIEEDPSNLMPF 277
            ...   :..|.|:..:      |:::||    .||.|::|.::|..|:     |....|:     
  Rat   366 TQELEILTDRLQLTLR------ALEDEKKKTDTLLYSVLPPSVANELR-----HKRPVPA----- 414

  Fly   278 TKTRHLFMEPHPEVSILEADMVDFTGLTTTMEVSD----LVAILHELFVSFDLAANHNR---ATR 335
                    :.:..|:||.:.:|.|....:.....:    :|.:|::|:..||...:..:   ..:
  Rat   415 --------KRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYK 471

  Fly   336 IKFLGDSYTCVTGIPSYFPTHANACVNQALDMIEISREVSKRRNKKIDLRIGVHSGEILAGIIGL 400
            ::.:||.|..|:|:|.....||.:..:.||||:||:.:| :...:.:.:.||:|:||::.|:||.
  Rat   472 VETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQV-QVDGESVQITIGIHTGEVVTGVIGQ 535

  Fly   401 TKWQFDIWSKDVDITNRLESSGLPGMVHISSRTLGLLDNHYVYEEGTD-------------TAKL 452
            ...::.::...|::|:|.|::|..|.:::|..|...|    :..|.:|             ..|.
  Rat   536 RMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCL----MSPENSDPQFHLEHRGPVSMKGKK 596

  Fly   453 DPL----LQRSNLSTYLIRSRLPNFEDTDDLEDDN 483
            :|:    |.|.|..|          |:|:  :|:|
  Rat   597 EPMQVWFLSRKNTGT----------EETN--QDEN 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 42/162 (26%)
CYCc 812..1051 CDD:214485
Nucleotidyl_cyc_III 841..1076 CDD:299850
Gucy1b1NP_036901.2 HNOB 2..166 CDD:285002
HNOBA 207..406 CDD:285003 25/110 (23%)
CYCc 385..584 CDD:214485 54/221 (24%)
Guanylate_cyc 412..605 CDD:278633 47/210 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.