DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32301 and Gucy2f

DIOPT Version :9

Sequence 1:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster
Sequence 2:NP_001007577.1 Gene:Gucy2f / 245650 MGIID:105119 Length:1108 Species:Mus musculus


Alignment Length:240 Identity:59/240 - (24%)
Similarity:124/240 - (51%) Gaps:33/240 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 NMLCMFLSRFQEY--NMRSGILSRYQVVYQNLVFQMAMKEEKA--LLDSIIPVTLARSLQDAIAS 265
            |::...|...::|  |:...|..|.:        ::.::::|.  ||..::|:::|.||:.... 
Mouse   819 NIIDSMLRMLEQYSSNLEDLIRERTE--------ELEIEKQKTEKLLTQMLPLSVAESLKKGCT- 874

  Fly   266 HIEEDPSNLMPFTKTRHLFMEPHPEVSILEADMVDFTGLTTTMEVSDLVAILHELFVSFDLAANH 330
             :|.:..:|                |::..:|:|.||.::...|..::|.:|::|:..||.....
Mouse   875 -VEPEGFDL----------------VTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGS 922

  Fly   331 NRATRIKFLGDSYTCVTGIPSYFPT-HANACVNQALDMIEISREVSKRRNKKID--LRIGVHSGE 392
            :...:::.:||:|...:|:|....: ||....|.:||::........|...::.  :|||:|||.
Mouse   923 HDVYKVETIGDAYMVASGLPKRNGSRHAAEIANMSLDILSSVGTFKMRHMPEVPVRIRIGLHSGP 987

  Fly   393 ILAGIIGLTKWQFDIWSKDVDITNRLESSGLPGMVHISSRTLGLL 437
            ::||::|||..::.::...|:..:|:||:|||..:|:|..|:.:|
Mouse   988 VVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVSLSTVTIL 1032

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 44/158 (28%)
CYCc 812..1051 CDD:214485
Nucleotidyl_cyc_III 841..1076 CDD:299850
Gucy2fNP_001007577.1 PBP1_sensory_GC_DEF-like 54..435 CDD:380594
PKc_like 545..815 CDD:419665
HNOBA <824..869 CDD:400168 10/52 (19%)
CYCc 848..1040 CDD:214485 53/203 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.