DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32301 and Gucy1a2

DIOPT Version :9

Sequence 1:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster
Sequence 2:NP_001028494.1 Gene:Gucy1a2 / 234889 MGIID:2660877 Length:730 Species:Mus musculus


Alignment Length:255 Identity:68/255 - (26%)
Similarity:116/255 - (45%) Gaps:59/255 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 AMKEEKA----LLDSIIPVTLARSL---QDAIASHIEEDPSNLMPFTKTRHLFMEPHPEVSILEA 296
            |::|||.    ||.||.|..:|:.|   |...|...:                     :|::|.:
Mouse   480 ALEEEKKKTVDLLYSIFPGDVAQQLWQGQQVQARKFD---------------------DVTMLFS 523

  Fly   297 DMVDFTGLTTTMEVSDLVAILHELFVSFDLAANHNRATRIKFLGDSYTCVTGIPSYFPTHANACV 361
            |:|.||.:........::::|:||:..||.........:::.:||:|...:|:......||....
Mouse   524 DIVGFTAICAQCTPMQVISMLNELYTRFDHQCGLLDIYKVETIGDAYCVASGLHRKSLCHAKPIA 588

  Fly   362 NQALDMIEISREVSKRRNKKIDLRIGVHSGEILAGIIGLTKWQFDIWSKDVDITNRLESSGLPGM 426
            ..||.|:|:|.||.....|.|.:|||:|||.:|||::|:...::.::..:|.:.::.||...|..
Mouse   589 LMALKMMELSEEVLTPDGKAIQMRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSHPRR 653

  Fly   427 VHISSRTLGLLDNHYVYEEGTDTAKLDPLLQRSNLSTYLIRSR--LPNFEDTDDLEDDNF 484
            :::|..|         |:          ||:|.:..|::.|||  ||          |||
Mouse   654 INVSPTT---------YQ----------LLKREDSFTFIPRSREELP----------DNF 684

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 42/155 (27%)
CYCc 812..1051 CDD:214485
Nucleotidyl_cyc_III 841..1076 CDD:299850
Gucy1a2NP_001028494.1 HNOB <157..268 CDD:285002
HNOBA 314..501 CDD:285003 9/20 (45%)
CYCc 483..672 CDD:214485 58/228 (25%)
Guanylate_cyc 512..696 CDD:278633 56/223 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.