DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32301 and Npr2

DIOPT Version :9

Sequence 1:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster
Sequence 2:NP_776149.1 Gene:Npr2 / 230103 MGIID:97372 Length:1047 Species:Mus musculus


Alignment Length:311 Identity:77/311 - (24%)
Similarity:136/311 - (43%) Gaps:71/311 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 VKNG-RAYFLGLAVSLFYFGYMALIDK-------ISTLDKVW-----ELTAYGAYLFFL------ 204
            |:|| |.||            ...||:       :..:::.|     |...:|....|:      
Mouse   740 VRNGQRPYF------------RPSIDRTQLNEELVLLMERCWAQDPTERPDFGQIKGFIRRFNKE 792

  Fly   205 ---NMLCMFLSRFQEY--NMRSGILSRYQVVYQNLVFQMAMKEEK----ALLDSIIPVTLARSLQ 260
               ::|...|.|.::|  |:...:..|.|          |..|||    |||..|:|.::|..|:
Mouse   793 GGTSILDNLLLRMEQYANNLEKLVEERTQ----------AYLEEKRKAEALLYQILPHSVAEQLK 847

  Fly   261 DAIASHIEEDPSNLMPFTKTRHLFMEPHPEVSILEADMVDFTGLTTTMEVSDLVAILHELFVSFD 325
                              :...:..|....|:|..:|:|.||.|:.......:|.:|::|:..||
Mouse   848 ------------------RGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFD 894

  Fly   326 LAANHNRATRIKFLGDSYTCVTGIPS-YFPTHANACVNQALDMIEI--SREVSKRRNKKIDLRIG 387
            ...::....:::.:||:|..|:|:|. ....||......||.:::.  |..:..|.:.::.||||
Mouse   895 AIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIG 959

  Fly   388 VHSGEILAGIIGLTKWQFDIWSKDVDITNRLESSGLPGMVHISSRTLGLLD 438
            ||:|.:.||::||...::.::...|:..:|:||:|....:|:||.|...||
Mouse   960 VHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALD 1010

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 47/159 (30%)
CYCc 812..1051 CDD:214485
Nucleotidyl_cyc_III 841..1076 CDD:299850
Npr2NP_776149.1 PBP1_NPR_B 26..421 CDD:380607
PK_GC-A_B 518..792 CDD:270944 12/63 (19%)
HNOBA <798..846 CDD:369471 17/57 (30%)
CYCc 825..1009 CDD:214485 55/201 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.