DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32301 and gcy-19

DIOPT Version :9

Sequence 1:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster
Sequence 2:NP_001348702.1 Gene:gcy-19 / 191650 WormBaseID:WBGene00001544 Length:1187 Species:Caenorhabditis elegans


Alignment Length:266 Identity:64/266 - (24%)
Similarity:134/266 - (50%) Gaps:31/266 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 YNMRSGILSRYQVVYQNLVFQMAMKEEKALLDSIIPVTLARSLQDAIASHIEEDPSNLMPFTKTR 281
            :|:.....:..:|..::...::..:::||      .|.|.|.|...:|..:::..:         
 Worm   853 FNILEDYTTNLEVEVEDRTKELTAEKKKA------DVLLGRMLPKQVAERLKQGQT--------- 902

  Fly   282 HLFMEPH--PEVSILEADMVDFTGLTTTMEVSDLVAILHELFVSFDLAANHNRATRIKFLGDSYT 344
               :||.  ..|::..:|:|.||.|........:|.:|::|:.:||.....:...:::.:||.|.
 Worm   903 ---VEPEGFDSVTVFFSDVVKFTQLAAKCSPFQVVNLLNDLYSNFDAIIEEHGCYKVESIGDGYL 964

  Fly   345 CVTGIPSYFPTHANACVNQ----ALDMIEI--SREVSKRRNKKIDLRIGVHSGEILAGIIGLTKW 403
            ||:|:||   .:.||.:.|    :||.:..  |.::.....:|::|||||:||..:||::||:..
 Worm   965 CVSGLPS---KNGNAHIKQIVELSLDFMSYCKSFKIPHLPREKVELRIGVNSGPCVAGVVGLSMP 1026

  Fly   404 QFDIWSKDVDITNRLESSGLPGMVHISSRTLGLLDNHYVYEEGTDTAKLDPLLQ-RSNLSTYLIR 467
            ::.::...|:..:|:||:|....:|:|:.:..||..||..:..| .::.|.::: :..:.|:.:.
 Worm  1027 RYCLFGDTVNTASRMESNGKASHIHLSAASYTLLMKHYPNQYNT-ASRGDVIIKGKGVMETFWVF 1090

  Fly   468 SRLPNF 473
            .|...|
 Worm  1091 ERNNQF 1096

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 48/163 (29%)
CYCc 812..1051 CDD:214485
Nucleotidyl_cyc_III 841..1076 CDD:299850
gcy-19NP_001348702.1 PBP1_NPR_GC_like 45..467 CDD:107347
PKc_like 571..841 CDD:328722
CYCc 876..1065 CDD:214485 56/209 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.