Sequence 1: | NP_728724.2 | Gene: | CG32301 / 38285 | FlyBaseID: | FBgn0052301 | Length: | 1111 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_506660.2 | Gene: | gcy-14 / 191647 | WormBaseID: | WBGene00001540 | Length: | 1111 | Species: | Caenorhabditis elegans |
Alignment Length: | 207 | Identity: | 55/207 - (26%) |
---|---|---|---|
Similarity: | 101/207 - (48%) | Gaps: | 33/207 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 242 EEKALLDSIIPVTLARSLQDAIASHIEEDPSNLMPFTKTRHLFMEPHPEVSILEADMVDFTGLTT 306
Fly 307 TMEVSDLVAILHELFVSFDLAANHNRATRIKFLGDSYTCVTGIPSYFPTHANACVNQ-------- 363
Fly 364 ---ALDMIEISREVSKRRNKKIDLRIGVHSGEILAGIIGLTKWQFDIWSKDVDITNRLESSGLPG 425
Fly 426 MVHISSRTLGLL 437 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32301 | NP_728724.2 | Nucleotidyl_cyc_III | 283..439 | CDD:299850 | 48/166 (29%) |
CYCc | 812..1051 | CDD:214485 | |||
Nucleotidyl_cyc_III | 841..1076 | CDD:299850 | |||
gcy-14 | NP_506660.2 | PBP1_NPR_GC_like | 21..423 | CDD:107347 | |
ANF_receptor | 43..418 | CDD:279440 | |||
PKc_like | 535..800 | CDD:304357 | |||
HNOBA | <817..860 | CDD:285003 | 6/20 (30%) | ||
CYCc | 839..1031 | CDD:214485 | 55/207 (27%) | ||
Guanylate_cyc | 866..1053 | CDD:278633 | 49/180 (27%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2114 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |