DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32301 and gcy-14

DIOPT Version :9

Sequence 1:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster
Sequence 2:NP_506660.2 Gene:gcy-14 / 191647 WormBaseID:WBGene00001540 Length:1111 Species:Caenorhabditis elegans


Alignment Length:207 Identity:55/207 - (26%)
Similarity:101/207 - (48%) Gaps:33/207 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 EEKALLDSIIPVTLARSLQDAIASHIEEDPSNLMPFTKTRHLFMEPHPEVSILEADMVDFTGLTT 306
            |||...|.::...|.:.:.|.:......:|              |...:|:|..:|:|.||.|..
 Worm   839 EEKKKSDVLLYRMLPKMVADKLKLGQTVEP--------------ETFEQVTIFFSDVVQFTTLAG 889

  Fly   307 TMEVSDLVAILHELFVSFDLAANHNRATRIKFLGDSYTCVTGIPSYFPTHANACVNQ-------- 363
            ......:|.:|::|:..||.....|...:::.:||.|.||:|:|     |.|.  |:        
 Worm   890 KCTPLQVVTLLNDLYTIFDGIIEQNDVYKVETIGDGYLCVSGLP-----HRNG--NEHIRHIARM 947

  Fly   364 ---ALDMIEISREVSKRRNKKIDLRIGVHSGEILAGIIGLTKWQFDIWSKDVDITNRLESSGLPG 425
               .|..:|..| |....:::|:||||::.|.::||::|||..::.::...|:..:|:||:|.||
 Worm   948 SLGFLSSLEFFR-VQHLPSERINLRIGINCGSVVAGVVGLTMPRYCLFGDAVNTASRMESNGKPG 1011

  Fly   426 MVHISSRTLGLL 437
            .:|:::....:|
 Worm  1012 KIHVTAEANQML 1023

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 48/166 (29%)
CYCc 812..1051 CDD:214485
Nucleotidyl_cyc_III 841..1076 CDD:299850
gcy-14NP_506660.2 PBP1_NPR_GC_like 21..423 CDD:107347
ANF_receptor 43..418 CDD:279440
PKc_like 535..800 CDD:304357
HNOBA <817..860 CDD:285003 6/20 (30%)
CYCc 839..1031 CDD:214485 55/207 (27%)
Guanylate_cyc 866..1053 CDD:278633 49/180 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.