DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32301 and gcy-6

DIOPT Version :9

Sequence 1:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster
Sequence 2:NP_001294696.1 Gene:gcy-6 / 191644 WormBaseID:WBGene00001533 Length:1086 Species:Caenorhabditis elegans


Alignment Length:215 Identity:51/215 - (23%)
Similarity:102/215 - (47%) Gaps:25/215 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 LLDSIIPV--TLARSLQDAIASHI-----EEDPSNLMPF-------TKTRHLFMEPHPE----VS 292
            |:|.:..|  :.|.:|:|.:|..:     |:..|:::.:       .....|.....||    |:
 Worm   830 LMDHVFNVLESYASTLEDEVAERMKELVEEKKKSDVLLYRMLPRQVADKLKLGQTVEPETFDIVT 894

  Fly   293 ILEADMVDFTGLTTTMEVSDLVAILHELFVSFDLAANHNRATRIKFLGDSYTCVTGIP-----SY 352
            :..:|:|.||.|........:|.:|:.|:..||.....:...:::.:||.|...:|:|     .:
 Worm   895 LFFSDVVSFTTLAGKCTPLQVVNLLNGLYTIFDGIIEQHDVYKVETIGDGYFVASGVPRRNGNEH 959

  Fly   353 FPTHANACVNQALDMIEISREVSKRRNKKIDLRIGVHSGEILAGIIGLTKWQFDIWSKDVDITNR 417
            ....|:..:|....:.:.|  :.....:||.:|:|.|.|.::||::|||..::.::...|:..:|
 Worm   960 TRNIASMSINFVKSLADFS--IPHLPGEKIKIRVGFHCGSVVAGVVGLTMPRYCLFGDAVNTASR 1022

  Fly   418 LESSGLPGMVHISSRTLGLL 437
            :||:..||.:|:|.....:|
 Worm  1023 MESNSKPGQIHLSEEANQML 1042

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 42/164 (26%)
CYCc 812..1051 CDD:214485
Nucleotidyl_cyc_III 841..1076 CDD:299850
gcy-6NP_001294696.1 PBP1_NPR_GC_like 29..445 CDD:107347
ANF_receptor 57..424 CDD:279440
PKc_like 585..822 CDD:304357
HNOBA <847..879 CDD:285003 4/31 (13%)
CYCc 858..1048 CDD:214485 44/187 (24%)
Guanylate_cyc 885..1070 CDD:278633 41/160 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.