DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32301 and gcy-4

DIOPT Version :9

Sequence 1:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster
Sequence 2:NP_496218.2 Gene:gcy-4 / 191642 WormBaseID:WBGene00001531 Length:1136 Species:Caenorhabditis elegans


Alignment Length:333 Identity:80/333 - (24%)
Similarity:162/333 - (48%) Gaps:52/333 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 NMLCMFLSRFQEYNMRSGILSRYQVVYQNLVFQMAMKEEKA--LLDSIIPVTLARSLQDAIASHI 267
            |::....|..:||.      |..:|.......::.::::|:  ||..::|..:|..|:...|  :
 Worm   826 NLMDHVFSMLEEYT------SSLEVEVGERTKELTLEKKKSDILLGRMLPKQVAERLKAGQA--V 882

  Fly   268 EEDPSNLMPFTKTRHLFMEPHPEVSILEADMVDFTGLTTTMEVSDLVAILHELFVSFDLAANHNR 332
            |.:..:|                |::..:|:|.||.|.:......:|.:|:::|.:||.....:.
 Worm   883 EPESFDL----------------VTVFFSDLVKFTDLASKCSPFQVVNLLNDVFSNFDSIIEKHD 931

  Fly   333 ATRIKFLGDSYTCVTGIPS-YFPTHANACVNQALDMIEISR--EVSKRRNKKIDLRIGVHSGEIL 394
            ..:::.:||.:.||:|:|: ....|....|..:|..:|..|  .:.....::::||:|::||..:
 Worm   932 VYKVESIGDGFLCVSGLPNRNGMEHIRQIVGMSLCFMEFCRNFRIPHLPRERVELRVGINSGPCV 996

  Fly   395 AGIIGLTKWQFDIWSKDVDITNRLESSGLPGMVHISSRTLGLLDNHYVYEEGT------------ 447
            ||::||:..::.::...|:..:|:||:|.|.|:|:|.....||.|:|.|:..|            
 Worm   997 AGVVGLSMPRYCLFGDTVNTASRMESNGKPSMIHMSEAAHSLLVNNYPYQFETNSRGEVIIKGKG 1061

  Fly   448 --DTAKLDPLLQRSNLSTYLIRS------RLPNFEDTDDLEDDNF-SLNDYRFSFSFSQDYEDIQ 503
              :|..|...:..||.||..|..      ::.:|.|: :|.:.:| |::.|..:.|.:.| |:|:
 Worm  1062 VMETYWLLGKMSLSNQSTPPITKVNHKPRKIASFTDS-ELTNYSFRSVSPYVENLSDNDD-EEIR 1124

  Fly   504 VKAQRDMI 511
            ...:|:|:
 Worm  1125 RVLRREMM 1132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 42/158 (27%)
CYCc 812..1051 CDD:214485
Nucleotidyl_cyc_III 841..1076 CDD:299850
gcy-4NP_496218.2 PBP1_NPR_GC_like 29..457 CDD:107347
ANF_receptor 49..423 CDD:279440
PKc_like 558..819 CDD:304357
HNOBA <834..876 CDD:285003 9/47 (19%)
CYCc 855..1047 CDD:214485 54/209 (26%)
Guanylate_cyc 882..1070 CDD:278633 50/203 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.