DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32301 and gcy-11

DIOPT Version :9

Sequence 1:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster
Sequence 2:NP_001359843.1 Gene:gcy-11 / 181745 WormBaseID:WBGene00001537 Length:1168 Species:Caenorhabditis elegans


Alignment Length:349 Identity:83/349 - (23%)
Similarity:162/349 - (46%) Gaps:67/349 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 STLDKVW-ELTAYGAYLFFLNMLCMFLSRFQEYNMRSGI---LSRYQVVYQNLV------FQMAM 240
            |.::|.| |..|....:..:..|...||:..:.|:...|   |.||:...::::      .:...
 Worm   861 SVVEKCWVEDPASRPSIKKVRELLKPLSKGLKGNIADNIMNLLDRYRNNLEDVIKERTEQLEDER 925

  Fly   241 KEEKALLDSIIPVTLARSLQDAIASHIEEDPSNLMPFTKTRHLFMEPHPEVSILEADMVDFTGLT 305
            |..::||..::|.::|.||::.                  :.:..|.:..|||..:|:|.||.|:
 Worm   926 KRNESLLLQLLPKSVANSLKNG------------------QPVDAEFYDSVSIYFSDIVGFTALS 972

  Fly   306 TTMEVSDLVAILHELFVSFDLAANHNRATRIKFLGDSYTCVTGIP---SYFPTHANACVNQALDM 367
            :......:|.:|:.|:.:||...:.....:::.:||:|..|:|:|   ||.  ||....:.:|::
 Worm   973 SKSTPLQVVNMLNNLYTNFDTIIDKFDCYKVETIGDAYMFVSGLPEVNSYL--HAGEVASASLEL 1035

  Fly   368 IEISR--EVSKRRNKKIDLRIGVHSGEILAGIIGLTKWQFDIWSKDVDITNRLESSGLPGMVHIS 430
            ::..:  .||...::|:.||||.|:|.::.|::|:...::.::...|.|.|.:||||.|..:.||
 Worm  1036 LDSIKTFTVSHCPDEKLRLRIGNHTGPVVTGVVGIRMPRYCLFGDTVIIANMMESSGEPMRIQIS 1100

  Fly   431 SRTLGLL--DNHYVYEEGTDTAKLDPLLQRSNLSTYLIRSRLPNFEDTDDLEDDNFSLNDYRFSF 493
            |....|:  ...||.|            ||..:   :::::         ||...:.:|||    
 Worm  1101 SDAYELILKCGGYVTE------------QREKI---VLKNK---------LEVMTYWMNDY---- 1137

  Fly   494 SFSQDYEDIQVKAQRDMILEVEHM 517
              |:|....::.|.::....:||:
 Worm  1138 --SKDARLARLVAHQEKFPHLEHL 1159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 48/162 (30%)
CYCc 812..1051 CDD:214485
Nucleotidyl_cyc_III 841..1076 CDD:299850
gcy-11NP_001359843.1 Periplasmic_Binding_Protein_type1 <234..452 CDD:385651
PKc_like 640..890 CDD:389743 8/28 (29%)
CYCc 923..1116 CDD:214485 57/212 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.