DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32301 and Npr3

DIOPT Version :9

Sequence 1:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster
Sequence 2:NP_032754.2 Gene:Npr3 / 18162 MGIID:97373 Length:536 Species:Mus musculus


Alignment Length:315 Identity:67/315 - (21%)
Similarity:107/315 - (33%) Gaps:92/315 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   360 CVNQALDMIEISREVSKRRNKKIDLRIGVHSGEILAGIIGL-TKWQFDIWS----------KDVD 413
            |.|:||  ..:...|:..|..|.||.:|.......|.:..| :.|...:.|          ||.:
Mouse   103 CGNRAL--FSLVDRVAAARGAKPDLILGPVCEYAAAPVARLASHWDLPMLSAGALAAGFQHKDTE 165

  Fly   414 ITNRLESSGLPGMVHISSRTLGLLDNHY------VYEEGTDTAKLD-----------PLLQRSNL 461
            .::....:  |....:....|.|..:|:      ||.:.    ||:           .:.|...|
Mouse   166 YSHLTRVA--PAYAKMGEMMLALFRHHHWSRAALVYSDD----KLERNCYFTLEGVHEVFQEEGL 224

  Fly   462 STYLIRSRLPNFEDTDDLEDDNFSLNDYRFSFSFSQDYEDIQVKAQRDMILEVEHMPVNRVQTCK 526
            .|...     ||::|.||:.|:.    .|:          || .::|.:|:......:.|:....
Mouse   225 HTSAY-----NFDETKDLDLDDI----VRY----------IQ-GSERVVIMCASGDTIRRIMLAV 269

  Fly   527 IRRPMHRIAKEDINEEYR-FHLESYYLFTTFRSWRMEWSFNKMRDLLMK--YSLGMMVFAGATI- 587
            .|..|       .:.:|. |::|   ||.:.......|......|...|  ||....|....|: 
Mouse   270 HRHGM-------TSGDYAFFNIE---LFNSSSYGDGSWRRGDKHDSEAKQAYSSLQTVTLLRTVK 324

  Fly   588 -----IAMDLLVKSEA-------MDYTMLF--------SLFLLILLPLLLASYKK 622
                 .:|:  |||..       .||..:|        .|::|.|..:|.|.|.|
Mouse   325 PEFEKFSME--VKSSVEKQGLNEEDYVNMFVEGFHDAILLYVLALHEVLRAGYSK 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 19/89 (21%)
CYCc 812..1051 CDD:214485
Nucleotidyl_cyc_III 841..1076 CDD:299850
Npr3NP_032754.2 PBP1_NPR_C_like 49..440 CDD:107381 67/315 (21%)
ANF_receptor 66..419 CDD:279440 67/315 (21%)
TM_EphA1 471..502 CDD:214014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.