DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32301 and Npr1

DIOPT Version :9

Sequence 1:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster
Sequence 2:NP_032753.5 Gene:Npr1 / 18160 MGIID:97371 Length:1057 Species:Mus musculus


Alignment Length:249 Identity:66/249 - (26%)
Similarity:120/249 - (48%) Gaps:37/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 NMLCMFLSRFQEY--NMRSGILSRYQVVYQNLVFQMAMKEEK----ALLDSIIPVTLARSLQDAI 263
            |:|...|||.::|  |:...:..|.|          |..|||    |||..|:|.::|..|:   
Mouse   807 NILDNLLSRMEQYANNLEELVEERTQ----------AYLEEKRKAEALLYQILPHSVAEQLK--- 858

  Fly   264 ASHIEEDPSNLMPFTKTRHLFMEPHPEVSILEADMVDFTGLTTTMEVSDLVAILHELFVSFDLAA 328
                           :...:..|....|:|..:|:|.||.|:.......:|.:|::|:..||...
Mouse   859 ---------------RGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVI 908

  Fly   329 NHNRATRIKFLGDSYTCVTGIP-SYFPTHANACVNQALDMIEISR--EVSKRRNKKIDLRIGVHS 390
            ::....:::.:||:|..|:|:| .....||......||.:::..|  .:..|..:::.||||:|:
Mouse   909 DNFDVYKVETIGDAYMVVSGLPVRNGQLHAREVARMALALLDAVRSFRIRHRPQEQLRLRIGIHT 973

  Fly   391 GEILAGIIGLTKWQFDIWSKDVDITNRLESSGLPGMVHISSRTLGLLDNHYVYE 444
            |.:.||::||...::.::...|:..:|:||:|....:|:||.|..:|:....:|
Mouse   974 GPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHLSSETKAVLEEFDGFE 1027

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 45/158 (28%)
CYCc 812..1051 CDD:214485
Nucleotidyl_cyc_III 841..1076 CDD:299850
Npr1NP_032753.5 PBP1_NPR_A 32..439 CDD:107380
ANF_receptor 50..410 CDD:279440
PK_GC-A_B 530..803 CDD:270944
TyrKc 543..797 CDD:197581
HNOBA <812..857 CDD:285003 17/54 (31%)
CYCc 836..1025 CDD:214485 55/206 (27%)
Guanylate_cyc 863..1049 CDD:278633 46/165 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.