DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32301 and gcy-32

DIOPT Version :9

Sequence 1:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster
Sequence 2:NP_506452.5 Gene:gcy-32 / 179887 WormBaseID:WBGene00001552 Length:684 Species:Caenorhabditis elegans


Alignment Length:300 Identity:69/300 - (23%)
Similarity:129/300 - (43%) Gaps:61/300 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 QNLVFQMAMKEEKALLDSIIPVTLARSLQDAIAS--HIEEDPSNLMPFTKTRHLFMEPHPEVSIL 294
            :.:..::.::.:|.  |||:...|.|.:...:.|  |||          ...|       |.:::
 Worm   411 ETMTRELELERQKT--DSILKDMLPRRIAQQLLSGEHIE----------ACEH-------EATVM 456

  Fly   295 EADMVDFTGLTTTMEVSDLVAILHELFVSFDLAANHNRATRIKFLGDSYTCVTGIPSYFPTHANA 359
            ..|:..|..........|:|.:|:|:|...|.........:::.:.|||..|:|||.|.|.||..
 Worm   457 FCDLPAFQQAIPQCSPKDIVNMLNEIFRKLDRIVVIRGVYKVETVSDSYMAVSGIPDYTPEHAEN 521

  Fly   360 CVNQALDMIEISREVSKRRNKKID--------LRIGVHSGEILAGIIGLTKWQFDIWSKDVDITN 416
            ..:.||.|:..:|.|       ||        ||||:|||.|.||::|....::.::.:.|.:.:
 Worm   522 MCHVALGMMWEARSV-------IDPVSKTPFLLRIGIHSGTITAGVVGTVHPKYCLFGETVTLAS 579

  Fly   417 RLESSGLPGMVHISSRTLGLLDNHYVYEEGTDTAKLD-------PLLQRSNLSTY-LIRSRLPNF 473
            ::||.|:.|.:..|.         :.|::..:|.:.:       .:.||....|| |.||...:.
 Worm   580 QMESLGMAGKIQCSK---------WAYQKAMETGRFEFSPRGRIDVKQRGLTETYFLTRSLKKSI 635

  Fly   474 EDTDDLEDDNFSLNDYRFSFSFSQDYEDIQVKAQRDMILE 513
            .:..| .|.:.::|..       :.||:::...:..:.::
 Worm   636 WEIID-HDRDINVNSI-------EGYEELETAIENAVTIK 667

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 44/163 (27%)
CYCc 812..1051 CDD:214485
Nucleotidyl_cyc_III 841..1076 CDD:299850
gcy-32NP_506452.5 HNOB 3..167 CDD:285002
HNOBA 226..440 CDD:285003 6/30 (20%)
CYCc 419..608 CDD:214485 57/223 (26%)
Guanylate_cyc 452..627 CDD:278633 50/190 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.