DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32301 and LRRK2

DIOPT Version :9

Sequence 1:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster
Sequence 2:NP_940980.4 Gene:LRRK2 / 120892 HGNCID:18618 Length:2527 Species:Homo sapiens


Alignment Length:855 Identity:165/855 - (19%)
Similarity:297/855 - (34%) Gaps:245/855 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KLLRYKCRELRLEGVYHRHCHLVSVA-------------LVTQLIIVIEILMLIHVILL---FSV 72
            |:|..|...|.:..:..:|.|...||             ..|.|.|:..::..|..::.   .|:
Human   434 KILLSKGIHLNVLELMQKHIHSPEVAESGCKMLNHLFEGSNTSLDIMAAVVPKILTVMKRHETSL 498

  Fly    73 VKNIDFLTVLPYFAVMLLTPSILMPSREPNVEQYESIAILVSC----LMALLLTAMD-------- 125
            ...::.|..:.:|.|    |.:...|||.....::...:...|    :..|:|.|::        
Human   499 PVQLEALRAILHFIV----PGMPEESREDTEFHHKLNMVKKQCFKNDIHKLVLAALNRFIGNPGI 559

  Fly   126 ------LILPICYF----RPFSLVPSYDHVVIVLIYLMFP------------IAFVKNGRAYFLG 168
                  :|..|.:|    ...||..:.|.|:..|  .|:|            |.::...:..|:|
Human   560 QKCGLKVISSIVHFPDALEMLSLEGAMDSVLHTL--QMYPDDQEIQCLGLSLIGYLITKKNVFIG 622

  Fly   169 --------LAVSLFYFGYMALIDK--ISTLDKVWELTAYGAYLFFLNM--LCMFLSRFQEYNMRS 221
                    |..||:.|..:|.|..  ..|:..:.:|:|..:.|...:.  |.:|      :.|.|
Human   623 TGHLLAKILVSSLYRFKDVAEIQTKGFQTILAILKLSASFSKLLVHHSFDLVIF------HQMSS 681

  Fly   222 GILSRYQVVYQNLVFQMAMKEEKALLDSIIPVTLARS-------------LQDAIASHIEEDPSN 273
            .|:.:....:.||..:...|  .|:.|.:..|.|.|:             |..|.|:..:|..|.
Human   682 NIMEQKDQQFLNLCCKCFAK--VAMDDYLKNVMLERACDQNNSIMVECLLLLGADANQAKEGSSL 744

  Fly   274 LMPFTKTRHLFMEPHPE-VSIL------EADMVDFTGLTTTMEVSDLVAILHELFVSFDLAANHN 331
            :....:     .|..|: |.:|      |.|:.....::.....|.::::|... ::.|:|.|. 
Human   745 ICQVCE-----KESSPKLVELLLNSGSREQDVRKALTISIGKGDSQIISLLLRR-LALDVANNS- 802

  Fly   332 RATRIKFLGDSYTCVTGI------PSY----FPTHANACVNQALDMIEISREVSKRRNKKIDLRI 386
                        .|:.|.      ||:    ||...:....|......::|.|. |...|..:..
Human   803 ------------ICLGGFCIGKVEPSWLGPLFPDKTSNLRKQTNIASTLARMVI-RYQMKSAVEE 854

  Fly   387 GVHSG-------EILAGIIGLTKWQFDIWSKDVDI--------TNRLESSGLPGMVHISSRTLGL 436
            |..||       ::|:        :||.|:...|.        ::.|:|.|..|...:..::..:
Human   855 GTASGSDGNFSEDVLS--------KFDEWTFIPDSSMDSVFAQSDDLDSEGSEGSFLVKKKSNSI 911

  Fly   437 LDNHYVYEEGTDTAKLDPLLQRSNLSTYLIRSRLPNFEDTDDLE--------DDNF--------- 484
            ....: |.:.. ..:..|.|||.:      .|..|.|:..|.|:        ||:.         
Human   912 SVGEF-YRDAV-LQRCSPNLQRHS------NSLGPIFDHEDLLKRKRKILSSDDSLRSSKLQSHM 968

  Fly   485 ----------SLNDYRFSFSFS-QDYEDIQVKAQRDMI-LEVEHMPVNRVQTCKIRRPMHRIAKE 537
                      |..:|..|...| .:..||...:|:..| :.:||:.         :..:|:.|..
Human   969 RHSDSISSLASEREYITSLDLSANELRDIDALSQKCCISVHLEHLE---------KLELHQNALT 1024

  Fly   538 DINEEY------RFHLESY-YLFTTFRSWRMEWSFNKMRDLLMKYSLGMMVFAGATIIAMDLLVK 595
            ...::.      ..||:.: ..||:|.|:.::.|.....| :.:..:|..|....|:....|  |
Human  1025 SFPQQLCETLKSLTHLDLHSNKFTSFPSYLLKMSCIANLD-VSRNDIGPSVVLDPTVKCPTL--K 1086

  Fly   596 SEAMDYTMLFSLFLLILLPLLLASYKKLWLRGRRLSPITQPTFF---------------LSRWFI 645
            ...:.|..|  .|:...|..::...::|.|.|.::|.|..|...               ||..|:
Human  1087 QFNLSYNQL--SFVPENLTDVVEKLEQLILEGNKISGICSPLRLKELKILNLSKNHISSLSENFL 1149

  Fly   646 KASDLIEKSVFVRIPLAIMVLFLLYVMS----SETVFSC--------------DIARLELEIINS 692
            :|...:| |...|:.....:.||...|:    |:..|||              |::..:::.:..
Human  1150 EACPKVE-SFSARMNFLAAMPFLPPSMTILKLSQNKFSCIPEAILNLPHLRSLDMSSNDIQYLPG 1213

  Fly   693 ELH----NLR 698
            ..|    |||
Human  1214 PAHWKSLNLR 1223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 34/187 (18%)
CYCc 812..1051 CDD:214485
Nucleotidyl_cyc_III 841..1076 CDD:299850
LRRK2NP_940980.4 Required for RAB29-mediated activation. /evidence=ECO:0000269|PubMed:29212815 1..969 111/584 (19%)
LRR 1 983..1004 6/20 (30%)
leucine-rich repeat 985..1012 CDD:275380 6/26 (23%)
LRR 1012..>1286 CDD:227223 45/227 (20%)
LRR 2 1012..1033 3/29 (10%)
leucine-rich repeat 1013..1036 CDD:275380 2/31 (6%)
LRR 3 1036..1057 6/20 (30%)
leucine-rich repeat 1037..1084 CDD:275380 11/47 (23%)
LRR 4 1059..1080 3/21 (14%)
LRR 5 1084..1105 6/24 (25%)
leucine-rich repeat 1085..1108 CDD:275380 6/26 (23%)
LRR 6 1108..1129 6/20 (30%)
leucine-rich repeat 1109..1130 CDD:275380 6/20 (30%)
LRR 7 1130..1150 3/19 (16%)
leucine-rich repeat 1131..1174 CDD:275380 9/43 (21%)
LRR 8 1174..1196 5/21 (24%)
leucine-rich repeat 1175..1197 CDD:275380 5/21 (24%)
LRR 9 1197..1218 2/20 (10%)
leucine-rich repeat 1198..1221 CDD:275380 2/22 (9%)
LRR 10 1221..1241 3/3 (100%)
leucine-rich repeat 1222..1246 CDD:275380 2/2 (100%)
LRR 11 1246..1267
leucine-rich repeat 1247..1269 CDD:275380
LRR 12 1269..1291
RocCOR 1334..1507 CDD:206741
COR 1527..1740 CDD:318343
STKc_LRRK2 1884..2135 CDD:270970
WD 1 2139..2183
WD 2 2188..2228
WD 3 2233..2276
WD 4 2281..2327
WD 5 2333..2377
WD 6 2402..2438
WD 7 2443..2497
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.