DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32301 and Gucy2e

DIOPT Version :9

Sequence 1:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster
Sequence 2:NP_570093.2 Gene:Gucy2e / 113911 RGDID:69322 Length:1123 Species:Rattus norvegicus


Alignment Length:224 Identity:55/224 - (24%)
Similarity:114/224 - (50%) Gaps:27/224 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 ILSRYQVVYQNLV------FQMAMKEEKALLDSIIPVTLARSLQDAIASHIEEDPSNLMPFTKTR 281
            :|.:|....:.||      .::..::.:.||..::|.::|.:|:  :.:.:|.            
  Rat   836 MLEKYSQSLEGLVQERTEELELERRKTERLLSQMLPPSVAHALK--MGTTVEP------------ 886

  Fly   282 HLFMEPHPEVSILEADMVDFTGLTTTMEVSDLVAILHELFVSFDLAANHNRATRIKFLGDSYTCV 346
                |...:|:|..:|:|.||.::...|..::|..|::|:..||...:.:...:::.:||:|...
  Rat   887 ----EYFDQVTIYFSDIVGFTTISALSEPIEVVGFLNDLYTMFDAVLDSHDVYKVETIGDAYMVA 947

  Fly   347 TGIPSYFPT-HANACVNQALDMIEISREVSKRRNKKIDLRI--GVHSGEILAGIIGLTKWQFDIW 408
            :|:|..... ||....|.||:::..:.....|....:.:|:  |:|||..:||::|||..::.::
  Rat   948 SGLPRRNGNRHAAEIANMALEILSYAGNFRMRHAPDVPIRVRAGLHSGPCVAGVVGLTMPRYCLF 1012

  Fly   409 SKDVDITNRLESSGLPGMVHISSRTLGLL 437
            ...|:..:|:||:|||..:|:|..|:..|
  Rat  1013 GDTVNTASRMESTGLPYRIHVSRNTVQAL 1041

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 45/158 (28%)
CYCc 812..1051 CDD:214485
Nucleotidyl_cyc_III 841..1076 CDD:299850
Gucy2eNP_570093.2 PBP1_sensory_GC_DEF-like 71..445 CDD:380594
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 529..556
PK_GC-2D 554..824 CDD:270945
CYCc 861..1050 CDD:214485 51/199 (26%)
Interaction with NCALD. /evidence=ECO:0000269|PubMed:18178149 880..921 11/56 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.