DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32301 and gucy2g

DIOPT Version :9

Sequence 1:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster
Sequence 2:XP_009305067.2 Gene:gucy2g / 100333350 ZFINID:ZDB-GENE-130531-70 Length:1127 Species:Danio rerio


Alignment Length:332 Identity:84/332 - (25%)
Similarity:145/332 - (43%) Gaps:67/332 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   783 VREGYLNYILK-ASYFMSMCFEKKHELTKVKTRTIKIIMANILPTHVAEVF----KVRRRSDQLY 842
            :.:..:|.:.| |::...:..|:..:||..|:|..| :::::||.::|:..    .|..||.::.
Zfish   821 ILDNMVNKLEKYANHLEEVVEERTSQLTVEKSRADK-LLSSMLPRYIADQLMAGKSVEPRSYEMV 884

  Fly   843 YENFSQVAVMFATIENYEADKSGLRALHEMICYFDELLVNYQSWYKIEKIKVMGWTYLAACGLHV 907
            ...||.: |.|.|:.:..:....:..|:::...||:::    ..|.:.|::.:|..|:.|.||  
Zfish   885 TIFFSDI-VGFTTMCSVSSALEVVTLLNDLYSLFDDII----KLYDVYKVETIGDAYMVASGL-- 942

  Fly   908 DHYTDFSVSVPISTNRESDKLQKSGSVRFAPMDGDEIMIKDLHPTQATTNEDDNTILVMTEFALN 972
                      |||..                         .||..:.:|            .||:
Zfish   943 ----------PISNG-------------------------TLHAEEIST------------MALH 960

  Fly   973 LLRILRDIRSKGIFFEKDSKLTGSLKIGIAHGPVMAGVVGLSKPHYDIWGHTVNMASRMTSTGVR 1037
            .|..::..:.:.:   .:.:|  :|:|||..|||:|||||.:.|.|.::|.|||.||||.|..:.
Zfish   961 FLSSIKRFKIRHL---PNERL--ALRIGINSGPVVAGVVGSTMPRYCLFGDTVNTASRMESNSLP 1020

  Fly  1038 DGIHVTESTANVLRDF-NIRCTYRGMTFVKGVGQVPTYLVDLDENLHFQQHSPD-NDSHKGSIVS 1100
            ..||:::|||::|... ......||...:||.|...|:.:.......|.....| |.|.|....|
Zfish  1021 LKIHISQSTADILLTIGTFELEERGDIEIKGKGTQKTFWLLSKPGFTFPPTGQDSNPSPKSGTDS 1085

  Fly  1101 VHWLDEK 1107
            .|...||
Zfish  1086 CHIKQEK 1092

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850
CYCc 812..1051 CDD:214485 62/242 (26%)
Nucleotidyl_cyc_III 841..1076 CDD:299850 60/235 (26%)
gucy2gXP_009305067.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.