DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32301 and gucy1a2

DIOPT Version :9

Sequence 1:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster
Sequence 2:XP_009290254.2 Gene:gucy1a2 / 100330875 ZFINID:ZDB-GENE-121023-3 Length:608 Species:Danio rerio


Alignment Length:252 Identity:69/252 - (27%)
Similarity:114/252 - (45%) Gaps:53/252 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 AMKEEKA----LLDSIIPVTLARSLQDAIASHIEEDPSNLMPFTKTRHLFMEPHPEVSILEADMV 299
            |::|||.    ||.||.|..:|:.|...:       |.....|           .:|::|.:|:|
Zfish   357 ALEEEKRRTVDLLYSIFPGDVAQRLWQGL-------PVQAKKF-----------DDVTMLFSDIV 403

  Fly   300 DFTGLTTTMEVSDLVAILHELFVSFDLAANHNRATRIKFLGDSYTCVTGIPSYFPTHANACVNQA 364
            .||.:........::::|:||:..||.........:|:.:||:|....|:.....:||......|
Zfish   404 GFTAVCAQCTPMQVISMLNELYTRFDYQCGILDVYKIETIGDAYCVAGGLHRKIDSHAKPIALMA 468

  Fly   365 LDMIEISREVSKRRNKKIDLRIGVHSGEILAGIIGLTKWQFDIWSKDVDITNRLESSGLPGMVHI 429
            |.|:|:|.||.....|.|.||||:|||.:|||::|:...::.::..:|.:.::.||...|..:::
Zfish   469 LKMMELSEEVLTPDGKPIKLRIGIHSGSVLAGVVGVMMPRYCLFGNNVTLASKFESGSHPRCINV 533

  Fly   430 SSRTLGLLDNHYVYEEGTDTAKLDPLLQRSNLSTYLIRSR--LPNFEDTDDLEDDNF 484
            |..|         |:          ||:.....|::.|||  ||          |||
Zfish   534 SPTT---------YQ----------LLRDDRSFTFIPRSRQELP----------DNF 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 44/155 (28%)
CYCc 812..1051 CDD:214485
Nucleotidyl_cyc_III 841..1076 CDD:299850
gucy1a2XP_009290254.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.