DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32301 and gucy1b1

DIOPT Version :9

Sequence 1:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster
Sequence 2:NP_001238874.1 Gene:gucy1b1 / 100150304 ZFINID:ZDB-GENE-090313-160 Length:608 Species:Danio rerio


Alignment Length:274 Identity:65/274 - (23%)
Similarity:135/274 - (49%) Gaps:45/274 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 ISTLDKVWELTAYGAYLFFLNM------LCMFLSRF-QEYNMRSGILSRYQVVYQNLVFQM-AMK 241
            :..||   :||..|.||..:.:      |.:...:| :||.:...:    :::...|...: |::
Zfish   327 VMNLD---DLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQEL----EILTDRLQHTLRALE 384

  Fly   242 EEK----ALLDSIIPVTLARSLQDAIASHIEEDPSNLMPFTKTRHLFMEPHPEVSILEADMVDFT 302
            :||    .||.|::|.::|..|:     |....|:             :.:..|:||.:.:|.|.
Zfish   385 DEKKKTDRLLYSVLPPSVANELR-----HKRPVPA-------------KRYDNVTILFSGIVGFN 431

  Fly   303 GLTTTMEVSD----LVAILHELFVSFDLAANHNR---ATRIKFLGDSYTCVTGIPSYFPTHANAC 360
            ...:....::    :|.:|::::..||:..:..:   ..:::.:||.|..|:|:|.....||.:.
Zfish   432 AFCSKHASAEGAIKIVNLLNDIYTRFDILTDSRKNPYVYKVETVGDKYMTVSGLPEPCTHHAKSI 496

  Fly   361 VNQALDMIEISREVSKRRNKKIDLRIGVHSGEILAGIIGLTKWQFDIWSKDVDITNRLESSGLPG 425
            .:.||||:||:.:| |.....:.:.||:|:||::.|:||....::.::...|::|:|.|::|..|
Zfish   497 CHLALDMMEIAGQV-KVDEDPVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKG 560

  Fly   426 MVHISSRTLGLLDN 439
            .:::|..|...|.:
Zfish   561 KINVSEYTYRCLQS 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 42/162 (26%)
CYCc 812..1051 CDD:214485
Nucleotidyl_cyc_III 841..1076 CDD:299850
gucy1b1NP_001238874.1 HNOB 2..166 CDD:285002
HNOBA 207..406 CDD:285003 20/85 (24%)
CYCc 385..584 CDD:214485 52/209 (25%)
Guanylate_cyc 412..605 CDD:278633 43/177 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.