DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXD and Phlpp1

DIOPT Version :9

Sequence 1:NP_620469.2 Gene:ACXD / 38284 FlyBaseID:FBgn0040507 Length:1162 Species:Drosophila melanogaster
Sequence 2:NP_598582.3 Gene:Phlpp1 / 98432 MGIID:2138327 Length:1687 Species:Mus musculus


Alignment Length:205 Identity:43/205 - (20%)
Similarity:75/205 - (36%) Gaps:46/205 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   966 GRRSRYDGARSSNADGVQRVP-YGNGSNIALDLDLERGQYEGNVITSGPRISSTHNGSSSNEVVR 1029
            |||.| .||....|.|...|| .|.|:|..|   |:||:.:.|:..:....||:...|:|:....
Mouse    71 GRRRR-RGAPQPAAGGAAPVPAAGGGANSLL---LKRGRLKRNLSAAAAASSSSSPSSASSAAGG 131

  Fly  1030 VMAEFALDLMRTMRRFNTENMQTEYE-------GSTDYGMLRIGISHGRAMAGVVGISKPHYDIW 1087
            :.|..:.......|..:.:.:..::.       ...|:      :.| :...|.|.:...|    
Mouse   132 LPASCSASASLCTRSLDRKTLLLKHRQLLQLQPSDRDW------VRH-QLQRGCVHVFDRH---- 185

  Fly  1088 GNPVNMASRMDSTGVPGQIQVTENTALKLREFNIQCNYRGMTFVKGRGNIPTYIIGIDSEYQFLP 1152
                     |.|:.:...:...:.||.::....:|..::|...||        ::|      :.|
Mouse   186 ---------MASSYLRPVLCTLDTTAAEVAARLLQLGHKGGGVVK--------VLG------YGP 227

  Fly  1153 HRPAAPTKED 1162
            ...|||...|
Mouse   228 PPAAAPAASD 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXDNP_620469.2 AC_N <42..284 CDD:292831
CYCc 254..476 CDD:214485
Nucleotidyl_cyc_III 321..503 CDD:299850
CYCc 856..1117 CDD:214485 33/158 (21%)
Nucleotidyl_cyc_III 878..1142 CDD:299850 37/183 (20%)
Phlpp1NP_598582.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..96 11/25 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 230..406 4/8 (50%)
PH_PHLPP-like 491..587 CDD:270131
PH 511..592 CDD:278594
LRR_RI 581..885 CDD:238064
LRR_8 594..659 CDD:290566
LRR 1 594..615
leucine-rich repeat 597..617 CDD:275380
LRR 2 617..638
leucine-rich repeat 618..648 CDD:275380
LRR_8 647..726 CDD:290566
LRR 3 648..669
LRR 4 671..692
leucine-rich repeat 672..694 CDD:275380
LRR 5 694..715
leucine-rich repeat 695..717 CDD:275380
LRR 6 717..739
leucine-rich repeat 718..740 CDD:275380
LRR 7 740..760
leucine-rich repeat 741..764 CDD:275380
LRR 8 764..785
LRR_RI 768..1030 CDD:238064
leucine-rich repeat 768..788 CDD:275380
LRR 9 788..809
leucine-rich repeat 789..809 CDD:275380
leucine-rich repeat 810..851 CDD:275380
LRR 10 829..850
LRR 11 851..872
leucine-rich repeat 852..874 CDD:275380
LRR 12 874..895
leucine-rich repeat 875..897 CDD:275380
LRR_8 896..954 CDD:290566
LRR 13 897..918
leucine-rich repeat 898..919 CDD:275380
LRR 14 919..940
leucine-rich repeat 920..943 CDD:275380
LRR 15 943..964
leucine-rich repeat 944..967 CDD:275380
LRR 16 969..989
LRR_8 970..1028 CDD:290566
leucine-rich repeat 970..993 CDD:275380
LRR 17 993..1014
leucine-rich repeat 994..1017 CDD:275380
LRR 18 1017..1038
LRR 19 1040..1061
LRR 20 1062..1083
leucine-rich repeat 1063..1085 CDD:275380
LRR 21 1085..1106
PP2Cc 1124..1376 CDD:214625
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1414..1465
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1604..1687
PDZ-binding 1685..1687
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.