DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXD and si:dkey-37g12.1

DIOPT Version :9

Sequence 1:NP_620469.2 Gene:ACXD / 38284 FlyBaseID:FBgn0040507 Length:1162 Species:Drosophila melanogaster
Sequence 2:XP_021333677.1 Gene:si:dkey-37g12.1 / 796669 ZFINID:ZDB-GENE-090312-145 Length:882 Species:Danio rerio


Alignment Length:412 Identity:100/412 - (24%)
Similarity:186/412 - (45%) Gaps:81/412 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 VMVLMDIGLNVYHATSHNDILNPIYDAYTLYAIYMFMPVPYLLQPFVLGSAVTFCYIINYSFVIT 200
            |:.:.|.|||.........  :|..|.:|.    :....|.||:..:..:......:  |||.|.
Zfish   497 VLKVTDFGLNSVRRLDTEQ--SPGSDPWTA----LLWRAPELLRQSIPANGTQKGDV--YSFAII 553

  Fly   201 AKDDNQMHSILNEAIYLSCVNLLGIFF-----RLMRDIALRT---------TFLDRRQYVE--EN 249
            |:          |.:|..     |.|:     ...|:|..|.         .::||.:.||  |:
Zfish   554 AQ----------EVVYRR-----GPFYIPNSHFSPREIVERVRAGGCSPSRPYIDRAECVEELES 603

  Fly   250 LLLRYARDQE---------RSLLLSILPAQIADRLQEDVKNRI------------ERSKQQHQQQ 293
            |::...|:..         |:.:....|..:::.:.:|:.:|:            ||:.:..:::
Zfish   604 LVVSCWRETPAERPDFSYIRTAIKKNSPHGVSENILDDLLSRMEQYACNLEEIVSERTAELQEEK 668

  Fly   294 SQVD------LRRSADSQTLKRWRQPDHGTLFIEPHEDVTVLYADVVNYTHLTTTLDVKKLVEAL 352
            .:.:      |.||..||.:.      ..|:..|.::.||:.::|:..:|.::.:|...::|..|
Zfish   669 KRAEGLLTQMLPRSVASQLIA------GKTVRAETYDCVTIYFSDIEGFTAMSASLTPMQVVNVL 727

  Fly   353 HDLFVRFDIASEEYNVLRIKFLGDCYYCVAGLANPNA-DHAKCCVDLGLRMIKDIRDVREKRHL- 415
            :||:..||...:.:||.:::.:||.|..|:||...|. ||||....:.|.:::.:|..... |: 
Zfish   728 NDLYTYFDNIIDYHNVYKVETIGDAYMVVSGLPIRNGDDHAKEIARMSLAIVQGLRSFHSP-HVP 791

  Fly   416 --NIDMRIGVHSGDVLSGVIGAAKWQFDIWSKDVDIANRLEATGATGRVHVSQKTLSLLDGEYFF 478
              .:.:|||||||..::||:|....::.::...|:.|:|:|:.|...::|||..|.||||   .|
Zfish   792 EQQLRVRIGVHSGPCVAGVVGLKMPRYCLFGDTVNTASRMESYGLPLKIHVSSSTKSLLD---TF 853

  Fly   479 EDGTEKAREDPVLQKHG-IRTF 499
            .:...:.|.|..::..| :|||
Zfish   854 RNFRCELRGDIHIKGKGWVRTF 875

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXDNP_620469.2 AC_N <42..284 CDD:292831 34/184 (18%)
CYCc 254..476 CDD:214485 64/252 (25%)
Nucleotidyl_cyc_III 321..503 CDD:299850 58/184 (32%)
CYCc 856..1117 CDD:214485
Nucleotidyl_cyc_III 878..1142 CDD:299850
si:dkey-37g12.1XP_021333677.1 Periplasmic_Binding_Protein_Type_1 <59..258 CDD:324556
PKc_like 355..628 CDD:328722 31/153 (20%)
HNOBA <641..687 CDD:311573 8/45 (18%)
CYCc 666..850 CDD:214485 54/190 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.