DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXD and Gucy1a2

DIOPT Version :9

Sequence 1:NP_620469.2 Gene:ACXD / 38284 FlyBaseID:FBgn0040507 Length:1162 Species:Drosophila melanogaster
Sequence 2:NP_076446.1 Gene:Gucy1a2 / 66012 RGDID:621655 Length:730 Species:Rattus norvegicus


Alignment Length:306 Identity:75/306 - (24%)
Similarity:136/306 - (44%) Gaps:48/306 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 LRTTFLDRRQYVEENLLLRYARDQERSLLLSILPAQIADRLQEDVKNRIERSKQQHQQQSQVDLR 299
            |:.|.....|.:||.      :.:...||.||.|..:|               ||..|:.||..|
  Rat   470 LKATLEKTHQALEEE------KKKTVDLLYSIFPGDVA---------------QQLWQRQQVQAR 513

  Fly   300 RSADSQTLKRWRQPDHGTLFIEPHEDVTVLYADVVNYTHLTTTLDVKKLVEALHDLFVRFDIASE 364
            :                      .:|||:|::|:|.:|.:.......:::..|::|:.|||....
  Rat   514 K----------------------FDDVTMLFSDIVGFTAICAQCTPMQVISMLNELYTRFDHQCG 556

  Fly   365 EYNVLRIKFLGDCYYCVAGLANPNADHAKCCVDLGLRMIKDIRDVREKRHLNIDMRIGVHSGDVL 429
            ..::.:::.:||.|...:||...:..|||....:.|:|::...:|.......|.||||:|||.||
  Rat   557 FLDIYKVETIGDAYCVASGLHRKSLCHAKPIALMALKMMELSEEVLTPDGRPIQMRIGIHSGSVL 621

  Fly   430 SGVIGAAKWQFDIWSKDVDIANRLEATGATGRVHVSQKTLSLL---DGEYFFEDGTEKAREDPVL 491
            :||:|....::.::..:|.:|::.|:.....|:::|..|..||   |...|.....|:..::...
  Rat   622 AGVVGVRMPRYCLFGNNVTLASKFESGSHPRRINISPTTYQLLKREDSFTFIPRSREELPDNFPK 686

  Fly   492 QKHGIRTFLIKSLRAPMHDPRRRMRERQVKKLSEASKANFMHNSTL 537
            :..|:..||  .||.....|:..:...::||:|......|:..::|
  Rat   687 EIPGVCYFL--ELRTGPKPPKPSLSSSRIKKVSYNIGTMFLRETSL 730

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXDNP_620469.2 AC_N <42..284 CDD:292831 11/48 (23%)
CYCc 254..476 CDD:214485 57/224 (25%)
Nucleotidyl_cyc_III 321..503 CDD:299850 50/184 (27%)
CYCc 856..1117 CDD:214485
Nucleotidyl_cyc_III 878..1142 CDD:299850
Gucy1a2NP_076446.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53
HNOB <157..268 CDD:285002
HNOBA 314..501 CDD:285003 10/36 (28%)
CYCc 483..672 CDD:214485 58/231 (25%)
Guanylate_cyc 512..696 CDD:278633 51/207 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.