DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXD and Gucy1a1

DIOPT Version :9

Sequence 1:NP_620469.2 Gene:ACXD / 38284 FlyBaseID:FBgn0040507 Length:1162 Species:Drosophila melanogaster
Sequence 2:NP_001343916.1 Gene:Gucy1a1 / 60596 MGIID:1926562 Length:691 Species:Mus musculus


Alignment Length:351 Identity:80/351 - (22%)
Similarity:151/351 - (43%) Gaps:104/351 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 IINYSFVI-------TAKDDNQMHSILNEAIYL-----------SCVNLL------GIFF----- 227
            ::|..|||       :.|..:::..:..:.||:           .||:.|      |::.     
Mouse   341 MLNMQFVIRVRRWDNSVKKSSRVMDLKGQMIYIVESSAILFLGSPCVDRLEDFTGRGLYLSDIPI 405

  Fly   228 -RLMRDIA------------------LRTTFLDRRQYVEENLLLRYARDQERS--LLLSILPAQI 271
             ..:||:.                  |:.|.....|.:||        :::|:  ||.||.|:::
Mouse   406 HNALRDVVLIGEQARAQDGLKKRLGKLKATLEHAHQALEE--------EKKRTVDLLCSIFPSEV 462

  Fly   272 ADRLQEDVKNRIERSKQQHQQQSQVDLRRSADSQTLKRWRQPDHGTLFIEPHEDVTVLYADVVNY 336
            |.:|.:   .:|.::|:                                  ..:||:|::|:|.:
Mouse   463 AQQLWQ---GQIVQAKK----------------------------------FSEVTMLFSDIVGF 490

  Fly   337 THLTTTLDVKKLVEALHDLFVRFDIASEEYNVLRIKFLGDCYYCVAGLANPNAD-HAKCCVDLGL 400
            |.:.:.....:::..|:.|:.|||....|.:|.:::.:||. |||||..:..:| ||.....:.|
Mouse   491 TAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDA-YCVAGGLHRESDTHAVQIALMAL 554

  Fly   401 RMIKDIRDVREKRHLNIDMRIGVHSGDVLSGVIGAAKWQFDIWSKDVDIANRLEATGATGRVHVS 465
            :|::...:|.......|.||||:|||.|.:||:|....::.::..:|.:||:.|:.....:::||
Mouse   555 KMMELSNEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNNVTLANKFESCSVPRKINVS 619

  Fly   466 QKTLSLL---DGEYFFEDGTEKARED 488
            ..|..||   .|..|    |.::||:
Mouse   620 PTTYRLLKDCPGFVF----TPRSREE 641

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXDNP_620469.2 AC_N <42..284 CDD:292831 26/141 (18%)
CYCc 254..476 CDD:214485 58/227 (26%)
Nucleotidyl_cyc_III 321..503 CDD:299850 52/172 (30%)
CYCc 856..1117 CDD:214485
Nucleotidyl_cyc_III 878..1142 CDD:299850
Gucy1a1NP_001343916.1 HNOBA 277..466 CDD:311573 25/132 (19%)
Guanylate_cyc 472..643 CDD:306677 53/209 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.