DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXD and CG34357

DIOPT Version :9

Sequence 1:NP_620469.2 Gene:ACXD / 38284 FlyBaseID:FBgn0040507 Length:1162 Species:Drosophila melanogaster
Sequence 2:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster


Alignment Length:278 Identity:73/278 - (26%)
Similarity:132/278 - (47%) Gaps:47/278 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 ADRLQEDVKNRIERSKQQHQQQSQVDLRRSADSQTLKRWRQPDHGT-----LFIEPHE--DVTVL 329
            ::.|:|.::.|.|          |:|:.|....|.|.|........     |.::|.|  |||:.
  Fly  1058 SNNLEELIRERTE----------QLDIERKKTEQLLNRMLPSSVAEKLKMGLAVDPEEFSDVTIY 1112

  Fly   330 YADVVNYTHLTTTLDVKKLVEALHDLFVRFDIASEEYNVLRIKFLGDCYYCVAGLANPNADHAKC 394
            ::|:|.:|.:.......::|:.|:||:..||.....|||.:::.:||.|..|:||.....|||:.
  Fly  1113 FSDIVGFTTIAAHCSPVQVVDLLNDLYTIFDATINAYNVYKVETIGDAYMVVSGLPVKIPDHAEQ 1177

  Fly   395 CVDLGLRMIKDIR--DVREKRHLNIDMRIGVHSGDVLSGVIGAAKWQFDIWSKDVDIANRLEATG 457
            ...:.|.::....  :|:....:.:.:|||:|:|...:||:|....::.::...|:.|:|:|:||
  Fly  1178 IATMALDLLHQSGRFNVKHLPGVPLQLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRMESTG 1242

  Fly   458 ATGRVHVSQKTLSLLD--GEYFFE---------------------DGTEK--AREDPVLQKHGIR 497
            ::.|:|:||:|...||  |.|..|                     .|.:|  ....|:.:.||:.
  Fly  1243 SSWRIHMSQETRDRLDARGGYAIEPRGLIDIKGKGMMNTFWLLGKKGFDKPLPAPPPIGESHGLD 1307

  Fly   498 TFLIK---SLRAPMHDPR 512
            ..||:   :|:|..:..|
  Fly  1308 ESLIRNSITLKAQANKSR 1325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXDNP_620469.2 AC_N <42..284 CDD:292831 3/11 (27%)
CYCc 254..476 CDD:214485 61/214 (29%)
Nucleotidyl_cyc_III 321..503 CDD:299850 59/213 (28%)
CYCc 856..1117 CDD:214485
Nucleotidyl_cyc_III 878..1142 CDD:299850
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810
CYCc 1074..1266 CDD:214485 56/191 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.