DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXD and npr3

DIOPT Version :9

Sequence 1:NP_620469.2 Gene:ACXD / 38284 FlyBaseID:FBgn0040507 Length:1162 Species:Drosophila melanogaster
Sequence 2:XP_005165413.1 Gene:npr3 / 569395 ZFINID:ZDB-GENE-060531-91 Length:503 Species:Danio rerio


Alignment Length:373 Identity:78/373 - (20%)
Similarity:118/373 - (31%) Gaps:141/373 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   721 CSSDEDYADLDPTYDERVQCFHPWILTNCMTLVIGMSFLFTRIPFIIKSCFSALIMIGYAVLVVS 785
            |..|..||.:|...|||..            ||:|            ..|..|...:   ..|.|
Zfish    78 CGMDALYALVDRQKDERPD------------LVLG------------PVCEYAASSV---TRVAS 115

  Fly   786 EFNFIYANSPSTNVNFNAK---YSHI-------LLMIITF------------------------- 815
            .:|....::.:....||:|   |||:       |.|..||                         
Zfish   116 HWNIPVISAGALATGFNSKTPEYSHLTRIAPTYLKMAETFQAIFGHFGWRTAYLIYDDDKDERNC 180

  Fly   816 -----GIFHLMER---QTEFIAKVDYNWKRQLIKKQEDALITN-------------DTIKVLLTN 859
                 |:|.::..   .|:| |.::.|.:|    ...|.:||:             |.::.|:  
Zfish   181 YFTMEGVFTVLSEYHISTDF-AVLNSNEER----VDPDGIITSVYGSEVVIMCSKADIVRDLM-- 238

  Fly   860 ILPTH----VAD--FYLSNQLQNELYY--------EEYD----------NVAVMFASIK----NF 896
             |..|    .:|  .:.:.:|.|...|        ::||          |...:..|.|    :|
Zfish   239 -LAAHRRKLTSDSHIFFNIELFNSSSYGDGSWRRRDKYDDEARAAYSFLNTVTLLRSTKPEFEDF 302

  Fly   897 DTD-KIGLRVLNEIICD-----------FDDVLNKYSQSLRVEKIKVANWTYMAACGLDVSRSEQ 949
            ..: |..|:..|..||:           |.|.|..|:.:||..|.|    ......||:::.|..
Zfish   303 SIEMKKSLQQSNIPICEDCSAVNMFMEGFHDALLLYAIALREVKSK----GLTKKNGLEITHSMW 363

  Fly   950 VNAPQMKFRNVSLMPNGRRS------RYDGARSSNADGVQRVPYGNGS 991
            ....:.....|||..||.|:      |.....|...:.|......|||
Zfish   364 NRTFEGIAGQVSLDANGDRNGDFSVVRMTDPESGKHETVMNYFGTNGS 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXDNP_620469.2 AC_N <42..284 CDD:292831
CYCc 254..476 CDD:214485
Nucleotidyl_cyc_III 321..503 CDD:299850
CYCc 856..1117 CDD:214485 41/182 (23%)
Nucleotidyl_cyc_III 878..1142 CDD:299850 35/154 (23%)
npr3XP_005165413.1 Periplasmic_Binding_Protein_Type_1 29..416 CDD:299141 78/373 (21%)
ANF_receptor 46..389 CDD:279440 72/349 (21%)
TM_EphA1 436..468 CDD:214014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.