DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXD and Phlpp2

DIOPT Version :9

Sequence 1:NP_620469.2 Gene:ACXD / 38284 FlyBaseID:FBgn0040507 Length:1162 Species:Drosophila melanogaster
Sequence 2:NP_001102601.2 Gene:Phlpp2 / 498949 RGDID:1562857 Length:1359 Species:Rattus norvegicus


Alignment Length:419 Identity:81/419 - (19%)
Similarity:137/419 - (32%) Gaps:141/419 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 LSILPAQIADRLQEDVKNRIERSKQQHQQQSQVDLRRSADSQT----------LKRWRQPDHGTL 318
            :.|||.         |..:||..|:  :|.|.......|.:||          .:||::.     
  Rat   230 MHILPL---------VGGKIEEVKR--RQHSLAFSSAGAQAQTYHVSFETLAEYQRWQRQ----- 278

  Fly   319 FIEPHEDVTVLYADVVNYTHLTTTLDVKKLVEALHDLFVRFDIA--SEEYNVLRIKFLG--DCYY 379
                       .:.||:....|..|....|.|....||...||.  :..:|.::::..|  |..|
  Rat   279 -----------ASKVVSQRISTVDLSCYSLEEVPEHLFYSQDITYLNLRHNFMQLERPGGLDTLY 332

  Fly   380 CVAGLANPNADHAKCCVDLGL--RMIKDIRDVREKRHLNIDMRIGVH-----------------S 425
            ..:.|...|..|.|    |||  .::.:|..:.|   ||:... |.|                 .
  Rat   333 KFSQLKGLNLSHNK----LGLFPVLLCEISTLTE---LNLSCN-GFHDLPSQIGNLLNLQTLCLD 389

  Fly   426 GDVLSGV------------IGAAKWQFD----------IWSKDVDIANRLEA--TGATGRV-HVS 465
            |:||:.:            :|.:...|.          :..|.|...||||.  .|...|: ||.
  Rat   390 GNVLTALPDELGNLQQLTSLGISFNNFSQIPEVLEKLTMLDKVVMAGNRLEILNLGVLTRMNHVK 454

  Fly   466 QKTLSLLDGEYFFEDGTEKAREDPVLQKHGIRTFLIKSLRAPMHDPRRRMRERQVKKLSEASKAN 530
            ...|.:                      :.::|.:|::|....|.....:|:.|:..|..:|.. 
  Rat   455 HVDLRM----------------------NHLKTVIIENLEGNKHITHMDLRDNQLTDLDLSSLC- 496

  Fly   531 FMHNSTLHQYNQVRNQAKLEMCRELDKMPIGRIQLTKVFRRSTRLTQDEI-------EEETFRRN 588
                 :|.|.:..|||        |.::.:....|..::....:||...:       ......||
  Rat   497 -----SLEQLHCERNQ--------LRELTLSGFSLRNLYANWNKLTAVNVYPVPSLLTSLELSRN 548

  Fly   589 ISSCCLFFRIRNWEFQYIKEPDVMLKYSI 617
            :..|     |.:|..:..|...:.:.|::
  Rat   549 LLEC-----IPDWACEAKKLEILDISYNL 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXDNP_620469.2 AC_N <42..284 CDD:292831 4/19 (21%)
CYCc 254..476 CDD:214485 57/269 (21%)
Nucleotidyl_cyc_III 321..503 CDD:299850 45/229 (20%)
CYCc 856..1117 CDD:214485
Nucleotidyl_cyc_III 878..1142 CDD:299850
Phlpp2NP_001102601.2 RA_PHLPP2 66..178 CDD:340761
PH_PHLPP-like 185..279 CDD:270131 14/75 (19%)
PLN00113 284..>762 CDD:215061 65/338 (19%)
leucine-rich repeat 289..309 CDD:275380 6/19 (32%)
leucine-rich repeat 310..336 CDD:275380 5/25 (20%)
leucine-rich repeat 337..359 CDD:275380 8/25 (32%)
leucine-rich repeat 360..382 CDD:275380 5/25 (20%)
leucine-rich repeat 383..405 CDD:275380 3/21 (14%)
leucine-rich repeat 406..428 CDD:275380 2/21 (10%)
leucine-rich repeat 429..452 CDD:275380 8/22 (36%)
leucine-rich repeat 453..476 CDD:275380 5/44 (11%)
leucine-rich repeat 477..497 CDD:275380 4/25 (16%)
leucine-rich repeat 498..517 CDD:275380 6/26 (23%)
leucine-rich repeat 518..539 CDD:275380 3/20 (15%)
leucine-rich repeat 540..562 CDD:275380 5/26 (19%)
leucine-rich repeat 563..584 CDD:275380 1/10 (10%)
leucine-rich repeat 586..607 CDD:275380
leucine-rich repeat 608..631 CDD:275380
leucine-rich repeat 632..681 CDD:275380
leucine-rich repeat 682..705 CDD:275380
leucine-rich repeat 706..728 CDD:275380
leucine-rich repeat 751..772 CDD:275380
PP2Cc 820..1069 CDD:238083
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.