DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXD and NPR3

DIOPT Version :9

Sequence 1:NP_620469.2 Gene:ACXD / 38284 FlyBaseID:FBgn0040507 Length:1162 Species:Drosophila melanogaster
Sequence 2:NP_001191304.1 Gene:NPR3 / 4883 HGNCID:7945 Length:541 Species:Homo sapiens


Alignment Length:324 Identity:58/324 - (17%)
Similarity:108/324 - (33%) Gaps:96/324 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   802 NAKYSHIL-----------LMIITFGIFHLMERQTEFIAKVDYNWKRQLIKKQEDALITNDTIKV 855
            :::|||:.           :|:..|...|               |.|..:...:|.|..|     
Human   168 DSEYSHLTRVAPAYAKMGEMMLALFRHHH---------------WSRAALVYSDDKLERN----- 212

  Fly   856 LLTNILPTHVADFYLSNQLQNELYYEEYDNVAVMFASIKNFDTDKIGLRVLNEIICDFDDVLNKY 920
                        .|.:.:..:|::.||     .:..||.:||..|         ..|.:|::...
Human   213 ------------CYFTLEGVHEVFQEE-----GLHTSIYSFDETK---------DLDLEDIVRNI 251

  Fly   921 SQSLRVEKIKVANWTYMAACGLDVSRSEQVNAPQMKFRNVSLMPNGRRSRYDGARSSNADGVQRV 985
            ..|.||..:..::.|..:.  :.|:....:.:....|.|:.|.           .||:       
Human   252 QASERVVIMCASSDTIRSI--MLVAHRHGMTSGDYAFFNIELF-----------NSSS------- 296

  Fly   986 PYGNGSNIALDLDLERGQYEGNVITSGPRISSTHNGSSSNEVVRVMAEFALDLMRTMRR--FNTE 1048
             ||:||       .:||  :.:...:....||....:....|.....:|::::..::.:  .|.|
Human   297 -YGDGS-------WKRG--DKHDFEAKQAYSSLQTVTLLRTVKPEFEKFSMEVKSSVEKQGLNME 351

  Fly  1049 NMQTEY-EGSTDYGMLRIGISHGRAMAGVVGISKPHYDIWGNPVNMASRMDSTGVPGQIQVTEN 1111
            :....: ||..|..:|.:...|....|   |.||..   .|..:.........|:.||:.:..|
Human   352 DYVNMFVEGFHDAILLYVLALHEVLRA---GYSKKD---GGKIIQQTWNRTFEGIAGQVSIDAN 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXDNP_620469.2 AC_N <42..284 CDD:292831
CYCc 254..476 CDD:214485
Nucleotidyl_cyc_III 321..503 CDD:299850
CYCc 856..1117 CDD:214485 47/259 (18%)
Nucleotidyl_cyc_III 878..1142 CDD:299850 45/237 (19%)
NPR3NP_001191304.1 PBP1_NPR_C_like 54..446 CDD:107381 58/324 (18%)
ANF_receptor 71..422 CDD:279440 58/324 (18%)
TM_EphA1 476..507 CDD:214014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.