DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXD and NPR2

DIOPT Version :9

Sequence 1:NP_620469.2 Gene:ACXD / 38284 FlyBaseID:FBgn0040507 Length:1162 Species:Drosophila melanogaster
Sequence 2:XP_024303324.1 Gene:NPR2 / 4882 HGNCID:7944 Length:1103 Species:Homo sapiens


Alignment Length:465 Identity:102/465 - (21%)
Similarity:194/465 - (41%) Gaps:127/465 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 VVLGVNF-RSELVSKHGWVVYATSWLAVC------VMVLMDIGLNVYHATSHNDILNPIYDAYTL 165
            :|.|:.| .:.::|.||.:..:.     |      |:.:.|.||..:.:|:..|      |::.|
Human   630 LVKGMAFLHNSIISSHGSLKSSN-----CVVDSRFVLKITDYGLASFRSTAEPD------DSHAL 683

  Fly   166 YA--------IYMFMPVP-------------YLLQPFVLGSA-VTFCYIINYSF---VITAKDDN 205
            ||        :::.:..|             ..:.|..||.| ....:...:.|   :.||.:..
Human   684 YASEAHPHNPLFILLLFPPRDGGRGRWSDSNIGMSPGGLGGAPFRGTWPAGFLFSEKLWTAPELL 748

  Fly   206 QMHSILNEAIYLSCVNLLGIFFRLMRDIALRT----------------------------TFLDR 242
            ..:.:....:..:.|...||   ::::||||:                            ..:||
Human   749 SGNPLPTTGMQKADVYSFGI---ILQEIALRSGPFYLEGLDLSPKEIVQKVRNGQRPYFRPSIDR 810

  Fly   243 RQYVEENLLL-----------------------RYARDQERSLLLSIL--PAQIADRLQEDVKNR 282
            .|..||.:||                       |:.::...|:|.::|  ..|.|:.|::.|:.|
Human   811 TQLNEELVLLMERCWAQDPAERPDFGQIKGFIRRFNKEGGTSILDNLLLRMEQYANNLEKLVEER 875

  Fly   283 IERSKQQHQQQSQVDLRRSAD-----------SQTLKRWRQPDHGTLFIEPHEDVTVLYADVVNY 336
                     .|:.::.:|.|:           ::.|||..     |:..|..:.||:.::|:|.:
Human   876 ---------TQAYLEEKRKAEALLYQILPHSVAEQLKRGE-----TVQAEAFDSVTIYFSDIVGF 926

  Fly   337 THLTTTLDVKKLVEALHDLFVRFDIASEEYNVLRIKFLGDCYYCVAGLANPNAD-HAKCCVDLGL 400
            |.|:......::|..|:||:..||...:.::|.:::.:||.|..|:||...|.. ||.....:.|
Human   927 TALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMAL 991

  Fly   401 RMIKDIRD--VREKRHLNIDMRIGVHSGDVLSGVIGAAKWQFDIWSKDVDIANRLEATGATGRVH 463
            .::..:..  :|.:.|..:.:|||||:|.|.:||:|....::.::...|:.|:|:|:.|...::|
Human   992 ALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIH 1056

  Fly   464 VSQKTLSLLD 473
            ||..|...||
Human  1057 VSSTTKDALD 1066

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXDNP_620469.2 AC_N <42..284 CDD:292831 48/260 (18%)
CYCc 254..476 CDD:214485 62/236 (26%)
Nucleotidyl_cyc_III 321..503 CDD:299850 47/156 (30%)
CYCc 856..1117 CDD:214485
Nucleotidyl_cyc_III 878..1142 CDD:299850
NPR2XP_024303324.1 Periplasmic_Binding_Protein_Type_1 26..421 CDD:324556
PK_GC-A_B 521..848 CDD:270944 40/231 (17%)
HNOBA <857..902 CDD:311573 9/53 (17%)
CYCc 881..1065 CDD:214485 51/188 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.