DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXD and CG31183

DIOPT Version :9

Sequence 1:NP_620469.2 Gene:ACXD / 38284 FlyBaseID:FBgn0040507 Length:1162 Species:Drosophila melanogaster
Sequence 2:NP_001287342.1 Gene:CG31183 / 41927 FlyBaseID:FBgn0051183 Length:1417 Species:Drosophila melanogaster


Alignment Length:314 Identity:75/314 - (23%)
Similarity:156/314 - (49%) Gaps:54/314 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 ENLLLRYARDQERSLLLSILPAQI---ADRLQEDVKNRIERSKQQHQQQSQVD------LRRSAD 303
            ::::.|:.:|.|...::..|..::   |:.|:|.|:   ||::..|:::.:.:      |.:|..
  Fly   874 KSMIRRFNKDNETGNIVDNLLKRMELYANNLEELVE---ERTQDYHEEKKKCEKLLYQLLPQSVA 935

  Fly   304 SQTLKRWRQPDHGTLFIEPHEDVTVLYADVVNYTHLTTTLDVKKLVEALHDLFVRFDIASEEYNV 368
            :|.:.  .||    :..|..:.||:.::|:|.:|.::......::|:.|:||:..||...|.::|
  Fly   936 AQLIS--GQP----VVAETFDQVTIYFSDIVGFTAISAESTPMQVVQFLNDLYTCFDSIVENFDV 994

  Fly   369 LRIKFLGDCYYCVAGLANPNAD-HAKCCVDLGLRMIKDIRDVR-----EKRHLNIDMRIGVHSGD 427
            .:::.:||.|..|:||...|.: ||:....|.|.:::.:.:.|     |.|   :.:|||:|:|.
  Fly   995 YKVETIGDAYMVVSGLPIRNGNQHAREIARLALALLEAVHNFRIHHRPEDR---LKLRIGLHTGA 1056

  Fly   428 VLSGVIGAAKWQFDIWSKDVDIANRLEATGATGRVHVSQKTLSLLD------------------G 474
            .::||:|....::.::...|:.|:|:|:.|...::|:|:.|...||                  |
  Fly  1057 CVAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHISETTKEALDEFGTFVTTRRGFVPMKGKG 1121

  Fly   475 E---YFFEDGTEKAREDPVLQKHGIRTFLIKSLRAPMHDPRRRMRERQVKKLSE 525
            |   |:.|.  |..|.:.::..    :.|:.:.|:.:..|:|.......|:.||
  Fly  1122 EMLTYWLEG--EVPRPNSLISP----SKLMLTRRSSLKQPQRSQSHNLHKQYSE 1169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXDNP_620469.2 AC_N <42..284 CDD:292831 8/38 (21%)
CYCc 254..476 CDD:214485 63/257 (25%)
Nucleotidyl_cyc_III 321..503 CDD:299850 53/208 (25%)
CYCc 856..1117 CDD:214485
Nucleotidyl_cyc_III 878..1142 CDD:299850
CG31183NP_001287342.1 PBP1_NPR_like 88..498 CDD:107368
ANF_receptor 108..473 CDD:279440
PK_GC-A_B 589..883 CDD:270944 1/8 (13%)
Pkinase_Tyr 613..877 CDD:285015 0/2 (0%)
HNOBA <893..938 CDD:285003 10/47 (21%)
CYCc 917..1108 CDD:214485 51/199 (26%)
Guanylate_cyc 944..1130 CDD:278633 49/188 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454014
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.