DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXD and GUCY1A1

DIOPT Version :9

Sequence 1:NP_620469.2 Gene:ACXD / 38284 FlyBaseID:FBgn0040507 Length:1162 Species:Drosophila melanogaster
Sequence 2:NP_000847.2 Gene:GUCY1A1 / 2982 HGNCID:4685 Length:690 Species:Homo sapiens


Alignment Length:431 Identity:99/431 - (22%)
Similarity:175/431 - (40%) Gaps:86/431 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 AVCVMVLMDIGLNVYHATSHNDILNPIYDAYTLYAIYMFMPVPYLLQPFVLGSAV----TFCYII 193
            |..|:...::.:::.....|||....:...|.||:::|....|.|.......|.|    .||...
Human   222 AAHVLYETEVEVSLMPPCFHNDCSEFVNQPYLLYSVHMKSTKPSLSPSKPQSSLVIPTSLFCKTF 286

  Fly   194 NYSFVITAKD------DNQMHSILNEAIYLSCVN---------------LLGIFFRLMRDIALRT 237
            .:.|:.. ||      .|.:..::|...:....|               ..||...|.....:|.
Human   287 PFHFMFD-KDMTILQFGNGIRRLMNRRDFQGKPNFEEYFEILTPKINQTFSGIMTMLNMQFVVRV 350

  Fly   238 TFLDRR---------------QYVEENLLL--------RYARDQERSLLLSILPAQIA------- 272
            ...|..               ..||.:.:|        |......|.|.||.:|...|       
Human   351 RRWDNSVKKSSRVMDLKGQMIYIVESSAILFLGSPCVDRLEDFTGRGLYLSDIPIHNALRDVVLI 415

  Fly   273 ---DRLQEDVKNRIERSK---QQHQQQSQVDLRRSAD----------SQTLKRWRQPDHGTLFIE 321
               .|.|:.:|.|:.:.|   :|..|..:.:.:::.|          :|.|  |:..   .:..:
Human   416 GEQARAQDGLKKRLGKLKATLEQAHQALEEEKKKTVDLLCSIFPCEVAQQL--WQGQ---VVQAK 475

  Fly   322 PHEDVTVLYADVVNYTHLTTTLDVKKLVEALHDLFVRFDIASEEYNVLRIKFLGDCYYCVAGLAN 386
            ...:||:|::|:|.:|.:.:.....:::..|:.|:.|||....|.:|.:::.:||. |||||..:
Human   476 KFSNVTMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDA-YCVAGGLH 539

  Fly   387 PNAD-HAKCCVDLGLRMIKDIRDVREKRHLNIDMRIGVHSGDVLSGVIGAAKWQFDIWSKDVDIA 450
            ..:| ||.....:.|:|::...:|.......|.||||:|||.|.:||:|....::.::..:|.:|
Human   540 KESDTHAVQIALMALKMMELSDEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNNVTLA 604

  Fly   451 NRLEATGATGRVHVSQKTLSLL---DGEYFFEDGTEKARED 488
            |:.|:.....:::||..|..||   .|..|    |.::||:
Human   605 NKFESCSVPRKINVSPTTYRLLKDCPGFVF----TPRSREE 641

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXDNP_620469.2 AC_N <42..284 CDD:292831 40/208 (19%)
CYCc 254..476 CDD:214485 65/248 (26%)
Nucleotidyl_cyc_III 321..503 CDD:299850 52/172 (30%)
CYCc 856..1117 CDD:214485
Nucleotidyl_cyc_III 878..1142 CDD:299850
GUCY1A1NP_000847.2 HNOBA 277..466 CDD:400168 32/189 (17%)
Guanylate_cyc 472..643 CDD:306677 52/175 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.