DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXD and Gucy1b1

DIOPT Version :9

Sequence 1:NP_620469.2 Gene:ACXD / 38284 FlyBaseID:FBgn0040507 Length:1162 Species:Drosophila melanogaster
Sequence 2:NP_036901.2 Gene:Gucy1b1 / 25202 RGDID:2769 Length:619 Species:Rattus norvegicus


Alignment Length:498 Identity:109/498 - (21%)
Similarity:196/498 - (39%) Gaps:144/498 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 HTLLLLTTPEIKY--VYVDMVAY--------------MCSGLVIWVVLGVNFRSELVSKHGWVVY 127
            ||..|:...|.|.  .|.|:..:              .|......::..   |..:|::.|..:|
  Rat   176 HTQFLIEEKESKEEDFYEDLDRFEENGTQDSRISPYTFCKAFPFHIIFD---RDLVVTQCGNAIY 237

  Fly   128 AT---------SWLAVCVMVLMDIGLNVYHATSHNDILNPIYDAYTLYAIYMFMPVPYLLQPFVL 183
            ..         |.|:|..:|...|.:      |.:.||:.|...:.|.:....:.|..|.....|
  Rat   238 RVLPQLQPGKCSLLSVFSLVRPHIDI------SFHGILSHINTVFVLRSKEGLLDVEKLECEDEL 296

  Fly   184 GSAVTFCYIINYSFVITAKDDNQMH----SILN------EAIYLSCVN---------LLGIFFR- 228
            ..|...|..:....:...:.|:.:.    |::|      ..:|||.:.         |||..|| 
  Rat   297 TGAEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFRE 361

  Fly   229 ---LMRDIALRTTFLDRRQYVEENLLLRYARDQER---SLLLSILPAQIADRLQEDVKNRIERSK 287
               |.:::.:.|   ||.|     |.||...|:::   :||.|:||..:|:.|            
  Rat   362 EYKLTQELEILT---DRLQ-----LTLRALEDEKKKTDTLLYSVLPPSVANEL------------ 406

  Fly   288 QQHQQQSQVDLRRSADSQTLKRWRQPDHGTLFIEPHEDVTVLYADVVNYT-----HLTTTLDVKK 347
             :|::  .|..:|                      :::||:|::.:|.:.     |.:.. ...|
  Rat   407 -RHKR--PVPAKR----------------------YDNVTILFSGIVGFNAFCSKHASGE-GAMK 445

  Fly   348 LVEALHDLFVRFDIASEEYN---VLRIKFLGDCYYCVAGLANPNADHAKCCVDLGLRMIKDIRDV 409
            :|..|:||:.|||..::...   |.:::.:||.|..|:||..|...||:....|.|.|::....|
  Rat   446 IVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQV 510

  Fly   410 REKRHLNIDMRIGVHSGDVLSGVIGAAKWQFDIWSKDVDIANRLEATGATGRVHVSQKTLSLL-- 472
            :.... ::.:.||:|:|:|::||||....::.::...|::.:|.|.||..|:::||:.|...|  
  Rat   511 QVDGE-SVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMS 574

  Fly   473 ----DGEYFFE-----------------------DGTEKARED 488
                |.::..|                       .|||:..:|
  Rat   575 PENSDPQFHLEHRGPVSMKGKKEPMQVWFLSRKNTGTEETNQD 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXDNP_620469.2 AC_N <42..284 CDD:292831 54/255 (21%)
CYCc 254..476 CDD:214485 58/238 (24%)
Nucleotidyl_cyc_III 321..503 CDD:299850 52/205 (25%)
CYCc 856..1117 CDD:214485
Nucleotidyl_cyc_III 878..1142 CDD:299850
Gucy1b1NP_036901.2 HNOB 2..166 CDD:285002
HNOBA 207..406 CDD:285003 46/215 (21%)
CYCc 385..584 CDD:214485 58/237 (24%)
Guanylate_cyc 412..605 CDD:278633 50/216 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.