DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXD and Gucy2f

DIOPT Version :9

Sequence 1:NP_620469.2 Gene:ACXD / 38284 FlyBaseID:FBgn0040507 Length:1162 Species:Drosophila melanogaster
Sequence 2:NP_001007577.1 Gene:Gucy2f / 245650 MGIID:105119 Length:1108 Species:Mus musculus


Alignment Length:338 Identity:79/338 - (23%)
Similarity:147/338 - (43%) Gaps:61/338 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 NLLGIFFRLMRDIALRTTFLDRRQYVEENLLLRYARDQERSLLLSILPAQIADRLQEDVKNRIER 285
            |::....|::...:.....|.|.:..|    |...:.:...||..:||..:|:.|::...     
Mouse   819 NIIDSMLRMLEQYSSNLEDLIRERTEE----LEIEKQKTEKLLTQMLPLSVAESLKKGCT----- 874

  Fly   286 SKQQHQQQSQVDLRRSADSQTLKRWRQPDHGTLFIEPH--EDVTVLYADVVNYTHLTTTLDVKKL 348
                                              :||.  :.||:.::|:|.:|.::...:..::
Mouse   875 ----------------------------------VEPEGFDLVTLYFSDIVGFTTISAMSEPIEV 905

  Fly   349 VEALHDLFVRFDIASEEYNVLRIKFLGDCYYCVAGLANPNAD-HAKCCVDLGLRMIKDIRDVREK 412
            |:.|:||:..||.....::|.:::.:||.|...:||...|.. ||....::.|.::..:...: .
Mouse   906 VDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPKRNGSRHAAEIANMSLDILSSVGTFK-M 969

  Fly   413 RHL---NIDMRIGVHSGDVLSGVIGAAKWQFDIWSKDVDIANRLEATGATGRVHVSQKTLSLLDG 474
            ||:   .:.:|||:|||.|::||:|....::.::...|:.|:|:|:||...|:|||..|:::|. 
Mouse   970 RHMPEVPVRIRIGLHSGPVVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVSLSTVTILQ- 1033

  Fly   475 EYFFEDGTE-KAREDPVLQKHGI-RTFLI---KSLRAPMHDPRRRMRERQV-KKLSEASKANFMH 533
              ...:|.| :.|....|:..|. .||.:   |....|:..|....::.|| ..|..|..|.|..
Mouse  1034 --TLSEGYEVELRGRTELKGKGTEETFWLVGKKGFTKPLPVPPPVGKDGQVGHGLQPAEIAAFQR 1096

  Fly   534 NSTLHQYNQVRNQ 546
            .....|.  |||:
Mouse  1097 RKAERQL--VRNK 1107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXDNP_620469.2 AC_N <42..284 CDD:292831 12/62 (19%)
CYCc 254..476 CDD:214485 53/227 (23%)
Nucleotidyl_cyc_III 321..503 CDD:299850 54/192 (28%)
CYCc 856..1117 CDD:214485
Nucleotidyl_cyc_III 878..1142 CDD:299850
Gucy2fNP_001007577.1 PBP1_sensory_GC_DEF-like 54..435 CDD:380594
PKc_like 545..815 CDD:419665
HNOBA <824..869 CDD:400168 10/48 (21%)
CYCc 848..1040 CDD:214485 54/234 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.