DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXD and PHLPP2

DIOPT Version :9

Sequence 1:NP_620469.2 Gene:ACXD / 38284 FlyBaseID:FBgn0040507 Length:1162 Species:Drosophila melanogaster
Sequence 2:NP_055835.2 Gene:PHLPP2 / 23035 HGNCID:29149 Length:1323 Species:Homo sapiens


Alignment Length:392 Identity:80/392 - (20%)
Similarity:144/392 - (36%) Gaps:97/392 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 LSILPAQIADRLQEDVKNRIERSKQQHQQQSQVDLRRSADSQT----------LKRWRQPDHGTL 318
            :.|||.         |..:||..|:  :|.|.......|.:||          .:||::.     
Human   194 MHILPL---------VGGKIEEVKR--RQYSLAFSSAGAQAQTYHVSFETLAEYQRWQRQ----- 242

  Fly   319 FIEPHEDVTVLYADVVNYTHLTTTLDVKKLVEALHDLFVRFDIA--SEEYNVLRIKFLG--DCYY 379
                       .:.||:....|..|....|.|....||...||.  :..:|.::::..|  |..|
Human   243 -----------ASKVVSQRISTVDLSCYSLEEVPEHLFYSQDITYLNLRHNFMQLERPGGLDTLY 296

  Fly   380 CVAGLANPNADHAKCCVDLGLRMIKDIRDVREKRHLNIDMRIGVHS-----GDVLSGVIGAAKWQ 439
            ..:.|...|..|.|    |||..|. :.::.....||:... |.|.     |::|:.........
Human   297 KFSQLKGLNLSHNK----LGLFPIL-LCEISTLTELNLSCN-GFHDLPSQIGNLLNLQTLCLDGN 355

  Fly   440 FDIWSKDVDIAN--RLEATGAT----GRVHVSQKTLSLLDGEYFFEDGTEKA------REDPV-- 490
            | :.:...::.|  :|.:.|.:    .::....:.|::||......:..|..      |.:.:  
Human   356 F-LTTLPEELGNLQQLSSLGISFNNFSQIPEVYEKLTMLDRVVMAGNCLEVLNLGVLNRMNHIKH 419

  Fly   491 --LQKHGIRTFLIKSLRAPMHDPRRRMRERQVKKLSEASKANFMHNSTLHQYNQVRNQAKLEMCR 553
              |:.:.::|.:|::|....|.....:|:.::..|..:|..      :|.|.:..|||       
Human   420 VDLRMNHLKTMVIENLEGNKHITHVDLRDNRLTDLDLSSLC------SLEQLHCGRNQ------- 471

  Fly   554 ELDKMPIGRIQLTKVFRRSTRLTQDEIEEE----TF---RRNISSCCLFFRIRNW--EFQYIKEP 609
             |.::.:....|..::..|.|||...:...    ||   .||:..|     :.:|  |.:.|:..
Human   472 -LRELTLSGFSLRTLYASSNRLTAVNVYPVPSLLTFLDLSRNLLEC-----VPDWACEAKKIEVL 530

  Fly   610 DV 611
            ||
Human   531 DV 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXDNP_620469.2 AC_N <42..284 CDD:292831 4/19 (21%)
CYCc 254..476 CDD:214485 49/236 (21%)
Nucleotidyl_cyc_III 321..503 CDD:299850 40/206 (19%)
CYCc 856..1117 CDD:214485
Nucleotidyl_cyc_III 878..1142 CDD:299850
PHLPP2NP_055835.2 PH_PHLPP-like 149..243 CDD:270131 14/75 (19%)
LRR 1 250..271 6/20 (30%)
leucine-rich repeat 253..273 CDD:275380 6/19 (32%)
LRR 2 273..296 5/22 (23%)
leucine-rich repeat 274..300 CDD:275380 5/25 (20%)
LRR 3 300..321 8/25 (32%)
leucine-rich repeat 301..323 CDD:275380 8/26 (31%)
LRR_RI 313..606 CDD:238064 46/242 (19%)
LRR_8 322..380 CDD:290566 10/59 (17%)
LRR 4 323..344 5/21 (24%)
leucine-rich repeat 324..346 CDD:275380 5/22 (23%)
LRR 5 346..368 2/22 (9%)
leucine-rich repeat 347..369 CDD:275380 2/22 (9%)
LRR 6 369..390 2/20 (10%)
leucine-rich repeat 370..416 CDD:275380 7/45 (16%)
LRR 7 392..412 3/19 (16%)
LRR 8 416..439 4/22 (18%)
leucine-rich repeat 418..440 CDD:275380 4/21 (19%)
LRR 9 440..460 4/19 (21%)
leucine-rich repeat 442..461 CDD:275380 3/24 (13%)
LRR 10 461..480 6/26 (23%)
leucine-rich repeat 462..481 CDD:275380 6/26 (23%)
LRR 11 481..502 5/20 (25%)
leucine-rich repeat 482..503 CDD:275380 5/20 (25%)
LRR 12 503..524 6/25 (24%)
leucine-rich repeat 504..526 CDD:275380 7/26 (27%)
LRR 13 526..547 3/7 (43%)
leucine-rich repeat 527..549 CDD:275380 3/6 (50%)
LRR_8 549..606 CDD:290566
LRR 14 549..570
leucine-rich repeat 550..565 CDD:275380
LRR 15 571..592
leucine-rich repeat 572..595 CDD:275380
LRR 16 595..616
leucine-rich repeat 596..645 CDD:275380
LRR 17 621..644
LRR_8 645..703 CDD:290566
LRR_4 645..685 CDD:289563
LRR 18 645..666
leucine-rich repeat 646..669 CDD:275380
LRR 19 669..690
leucine-rich repeat 670..692 CDD:275380
LRR 20 692..713
leucine-rich repeat 693..714 CDD:275380
LRR 21 714..735
leucine-rich repeat 715..734 CDD:275380
LRR 22 737..758
leucine-rich repeat 738..764 CDD:275380
PP2Cc 784..1033 CDD:238083
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1060..1157
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1285..1323
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.