DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXD and gcy-23

DIOPT Version :9

Sequence 1:NP_620469.2 Gene:ACXD / 38284 FlyBaseID:FBgn0040507 Length:1162 Species:Drosophila melanogaster
Sequence 2:NP_500309.3 Gene:gcy-23 / 191652 WormBaseID:WBGene00001548 Length:1073 Species:Caenorhabditis elegans


Alignment Length:340 Identity:73/340 - (21%)
Similarity:148/340 - (43%) Gaps:83/340 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 LYAIYMFM-PVPYLLQPFVLGSAVTFCYIINY------SFVITAKDDNQMHSILNEAIYLSCVN- 221
            :||..|.| .:.:...||..|:.|:  .:::|      :|..|..|..|:|..| .|:.|.|.| 
 Worm   728 IYAFGMVMHEILFRALPFPNGTNVS--EVMDYIRDGTKTFRPTVHDRTQIHPDL-VALLLDCWNE 789

  Fly   222 ------------------------LLGIFFRLMRDIA--LRTTFLDRRQYVEENLLLRYARDQER 260
                                    |:....|:|...|  |.....:|...:||      |..:..
 Worm   790 NPEVRPSIRRVRLNTENYLKVKGSLVDQMMRMMEQYANNLEKLVAERTGMLEE------ANVRAD 848

  Fly   261 SLLLSILPAQIADRLQEDVKNRIERSKQQHQQQSQVDLRRSADSQTLKRWRQPDHGTLFIEPHED 325
            .||..:||..:|:.|:                     :.||..::|.                :.
 Worm   849 KLLGQLLPKYVANELK---------------------MGRSVPAKTF----------------DM 876

  Fly   326 VTVLYADVVNYTHLTTTLDVKKLVEALHDLFVRFDIASEEYNVLRIKFLGDCYYCVAGLANPNA- 389
            .||:::|:|.:|.:.::....::|..|:.::.:||.|..::...:::.:||.|..|:|:...|. 
 Worm   877 ATVMFSDIVGFTTICSSSTPLEVVSMLNSIYSKFDDAINKHGSYKVETIGDAYMIVSGIPEENGN 941

  Fly   390 DHAK--CCVDLGLRMIKDIRDVREKRHLNIDMRIGVHSGDVLSGVIGAAKWQFDIWSKDVDIANR 452
            :|.:  |...|.|.::....::..:|::.:.:|:|:|:|.|.:||:|....::.::...|::|:|
 Worm   942 EHIRNICNTALELMLLLKTYEIPHRRNVKLRIRLGIHTGTVAAGVVGLTAPRYCLFGDTVNVASR 1006

  Fly   453 LEATGATGRVHVSQK 467
            :|:|....::.:||:
 Worm  1007 MESTSEPEKIQMSQE 1021

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXDNP_620469.2 AC_N <42..284 CDD:292831 34/152 (22%)
CYCc 254..476 CDD:214485 46/217 (21%)
Nucleotidyl_cyc_III 321..503 CDD:299850 36/150 (24%)
CYCc 856..1117 CDD:214485
Nucleotidyl_cyc_III 878..1142 CDD:299850
gcy-23NP_500309.3 Periplasmic_Binding_Protein_Type_1 38..407 CDD:299141
ANF_receptor 38..385 CDD:279440
PK_GC 509..806 CDD:270894 19/80 (24%)
HNOBA <817..863 CDD:285003 13/51 (25%)
CYCc 842..1035 CDD:214485 47/223 (21%)
Guanylate_cyc 869..1056 CDD:278633 37/169 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.