DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXD and gcy-17

DIOPT Version :9

Sequence 1:NP_620469.2 Gene:ACXD / 38284 FlyBaseID:FBgn0040507 Length:1162 Species:Drosophila melanogaster
Sequence 2:NP_001293327.1 Gene:gcy-17 / 191649 WormBaseID:WBGene00001542 Length:1088 Species:Caenorhabditis elegans


Alignment Length:291 Identity:81/291 - (27%)
Similarity:147/291 - (50%) Gaps:44/291 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 DQERSLLLSI--------------LPAQIADRLQEDVKNRIERSKQ--QHQQQSQVDLRRSADSQ 305
            ||.||||..:              :....|..|:|:|.   ||:|:  :.|::|.|.|.|.....
 Worm   801 DQVRSLLRGMNDGKKGNLMDHVFNMLETYASTLEEEVN---ERTKELVEEQKKSDVLLYRMLPKT 862

  Fly   306 TLKRWRQPDHGTLFIEPH--EDVTVLYADVVNYTHLTTTLDVKKLVEALHDLFVRFDIASEEYNV 368
            ..::.:    ..:.|||.  |.||:.::|||.:|.|.:.....::|:.|:||:..||...|:.:|
 Worm   863 VAEKLK----AGISIEPETFELVTIFFSDVVQFTTLASKCTPLQVVQLLNDLYTIFDSIIEQNDV 923

  Fly   369 LRIKFLGDCYYCVAGLANPNA-DHAKCCVDLGLRMIKDIRDVREKRHL---NIDMRIGVHSGDVL 429
            .:::.:||.|.||:||.:.|. ||.|....:.|..:..:.:.| ..|:   .|::|||::.|.|:
 Worm   924 YKVETIGDGYLCVSGLPHRNGHDHIKHIARMSLAFLSSLAEFR-VAHMPSERINLRIGINCGSVV 987

  Fly   430 SGVIGAAKWQFDIWSKDVDIANRLEATGATGRVHVSQKTLSLLD---GEYFFEDGTEKAREDPVL 491
            :||:|....::.::...|:.|:|:|:.|..||:|||.:...||.   |.:..|:     |.:.::
 Worm   988 AGVVGLTMPRYCLFGDAVNTASRMESNGKPGRIHVSSEANHLLTHVVGGFRTEE-----RGEVII 1047

  Fly   492 QKHGIRT---FLIKSLRAPMHDPRRRMRERQ 519
            :..|:..   .|.::...|:   :..||:|:
 Worm  1048 KGKGVMNTYWLLGENDSVPV---KSNMRKRE 1075

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXDNP_620469.2 AC_N <42..284 CDD:292831 10/40 (25%)
CYCc 254..476 CDD:214485 73/243 (30%)
Nucleotidyl_cyc_III 321..503 CDD:299850 58/193 (30%)
CYCc 856..1117 CDD:214485
Nucleotidyl_cyc_III 878..1142 CDD:299850
gcy-17NP_001293327.1 Periplasmic_Binding_Protein_Type_1 25..404 CDD:299141
ANF_receptor 47..398 CDD:279440
PKc_like 539..808 CDD:304357 5/6 (83%)
Pkinase 567..803 CDD:278497 1/1 (100%)
HNOBA <824..867 CDD:285003 12/45 (27%)
CYCc 846..1038 CDD:214485 60/196 (31%)
Guanylate_cyc 873..1060 CDD:278633 58/192 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.