DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXD and gcy-15

DIOPT Version :9

Sequence 1:NP_620469.2 Gene:ACXD / 38284 FlyBaseID:FBgn0040507 Length:1162 Species:Drosophila melanogaster
Sequence 2:NP_001364713.1 Gene:gcy-15 / 191648 WormBaseID:WBGene00001541 Length:1104 Species:Caenorhabditis elegans


Alignment Length:317 Identity:72/317 - (22%)
Similarity:139/317 - (43%) Gaps:54/317 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 IALRTTFLDRRQYVEENLLLRYARDQERSLLLSILPAQIADRLQEDVKNRIERSKQQHQQQSQVD 297
            |.|:.|.:|.                    ::|:: .:..|:|::|:..|.|..:.:        
 Worm   824 IGLKRTIMDN--------------------MVSMI-EKYTDKLEKDIAERNEELEAE-------- 859

  Fly   298 LRRSADSQTLKRWRQPD--------HGTLFIEPHEDVTVLYADVVNYTHLTTTLDVKKLVEALHD 354
               .|.|:.|.:...|:        ...:..|..|:.||.::|...:..::.|.....:|:.|:|
 Worm   860 ---KAKSEALLKMMLPEVVADSLKLGSNVSAESFENCTVFFSDCPGFVEMSATSKPIDIVQFLND 921

  Fly   355 LFVRFDIASEEYNVLRIKFLGDCYYCVAGLANPNAD-HAKCCVDLGLRMIKDIRDVREKRHL--- 415
            |:..||...::::|.:::.:.|.|...:||..||.: ||.....|||.::|.:...: .|||   
 Worm   922 LYTVFDRIIDQFDVYKVETIADAYMVASGLPVPNGNHHAGEIASLGLALLKAVESFK-IRHLPNE 985

  Fly   416 NIDMRIGVHSGDVLSGVIGAAKWQFDIWSKDVDIANRLEATGATGRVHVSQKTLSLLD--GEYFF 478
            .:.:|||::||..::||:|....::.::...|:.|:|:|:.|...|::.|.....:||  |.|..
 Worm   986 KVRLRIGMNSGPCVAGVVGLKMPRYCLFGDTVNTASRMESNGIPLRINCSGTAKEILDQLGGYEI 1050

  Fly   479 EDGTEKAREDPVLQKHGIRTFLIKSLRAPMHDPRRRMRERQVKKLSEASKANFMHNS 535
            |       |..:::..|....:...:|....|.||....|:..|.:...||.....:
 Worm  1051 E-------ERGIVEMKGKGKQMTYFVRGENSDMRRERIIRERVKFASLKKAQIQEKT 1100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXDNP_620469.2 AC_N <42..284 CDD:292831 9/50 (18%)
CYCc 254..476 CDD:214485 56/235 (24%)
Nucleotidyl_cyc_III 321..503 CDD:299850 50/187 (27%)
CYCc 856..1117 CDD:214485
Nucleotidyl_cyc_III 878..1142 CDD:299850
gcy-15NP_001364713.1 Periplasmic_Binding_Protein_type1 2..363 CDD:415822
PK_GC 553..822 CDD:270894
HNOBA <831..879 CDD:400168 11/79 (14%)
Guanylate_cyc 885..1071 CDD:306677 50/193 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.