DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXD and gcy-1

DIOPT Version :9

Sequence 1:NP_620469.2 Gene:ACXD / 38284 FlyBaseID:FBgn0040507 Length:1162 Species:Drosophila melanogaster
Sequence 2:NP_496039.1 Gene:gcy-1 / 191639 WormBaseID:WBGene00001528 Length:1137 Species:Caenorhabditis elegans


Alignment Length:363 Identity:87/363 - (23%)
Similarity:160/363 - (44%) Gaps:78/363 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 VTFCYIINYSFVITAKD------------DN---QMHSILNEAIYLSCVNLLGIFFRLMRDIALR 236
            :|..:.:|.:.:...||            :|   ||..::::    ...||:...|.::.:.   
 Worm   788 ITDIHDVNPALIALVKDCWAEVPEDRPTAENICSQMKGLVSK----QKTNLMDHVFNMLEEY--- 845

  Fly   237 TTFLDRRQYVEENLLLRYARDQERSLLLS-ILPAQIADRLQEDVKNRIERSKQQHQQQSQVDLRR 300
            |:.|:  :.:||.........::..:||| :||.|:|:||:.                       
 Worm   846 TSTLE--EEIEERTKELTLEKKKADILLSRMLPKQVAERLKA----------------------- 885

  Fly   301 SADSQTLKRWRQPDHGTLFIEPH--EDVTVLYADVVNYTHLTTTLDVKKLVEALHDLFVRFDIAS 363
               .||             :||.  :.|||.::|||.:|.|.:.....:.|..|:||:..||...
 Worm   886 ---GQT-------------VEPEGFDSVTVFFSDVVKFTILASKCSPFQTVNLLNDLYSNFDTII 934

  Fly   364 EEYNVLRIKFLGDCYYCVAGLANPNA-DHAKCCVDLGLRMIKDIRDVREKRHL---NIDMRIGVH 424
            |::.|.:::.:||.|.||:||...|. .|.|..||:.|:.::..:..... ||   |:::||||:
 Worm   935 EQHGVYKVESIGDGYLCVSGLPTRNGYAHIKQIVDMSLKFMEYCKSFNIP-HLPRENVELRIGVN 998

  Fly   425 SGDVLSGVIGAAKWQFDIWSKDVDIANRLEATGATGRVHVSQKTLSLLDGEYFFEDGTEKAREDP 489
            ||..::||:|.:..::.::...|:.|:|:|:.|....:|::....|||...|..:..|....|..
 Worm   999 SGPCVAGVVGLSMPRYCLFGDTVNTASRMESNGKPSLIHLTNDAHSLLTTHYPNQYETSSRGEVI 1063

  Fly   490 VLQKHGIRTFLIKSLRAPMHDPRRRMRERQVKKLSEAS 527
            :..|..:.||.:       |.....|...:::.:|..|
 Worm  1064 IKGKGVMETFWV-------HGRFGEMEPTELRSISNRS 1094

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXDNP_620469.2 AC_N <42..284 CDD:292831 23/112 (21%)
CYCc 254..476 CDD:214485 63/228 (28%)
Nucleotidyl_cyc_III 321..503 CDD:299850 58/187 (31%)
CYCc 856..1117 CDD:214485
Nucleotidyl_cyc_III 878..1142 CDD:299850
gcy-1NP_496039.1 PBP1_NPR_GC_like 35..449 CDD:107347
ANF_receptor 53..432 CDD:279440
PKc_like 555..821 CDD:304357 5/32 (16%)
HNOBA <840..883 CDD:285003 11/47 (23%)
CYCc 862..1051 CDD:214485 63/228 (28%)
Guanylate_cyc 889..1077 CDD:278633 58/195 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.