DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXD and gcy-11

DIOPT Version :9

Sequence 1:NP_620469.2 Gene:ACXD / 38284 FlyBaseID:FBgn0040507 Length:1162 Species:Drosophila melanogaster
Sequence 2:NP_001359843.1 Gene:gcy-11 / 181745 WormBaseID:WBGene00001537 Length:1168 Species:Caenorhabditis elegans


Alignment Length:468 Identity:98/468 - (20%)
Similarity:195/468 - (41%) Gaps:110/468 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 VIWVVLGVNFRSELVSKHGWVVYATSWLAVCVMVLMDIGLNVYHATSH-----NDILN------- 157
            ::|      |..|::.::. |.:..|.|.:....:..:.:.:|.....     :|:|:       
 Worm   778 LLW------FAPEIIRRYA-VKHDLSKLELAKADIYSLAIVLYEIYGRQGPFGDDLLDSDEIIEQ 835

  Fly   158 ---PIYDAYTLYAIYMFMPVPYLLQPFVLGSAVTFCYIINYSFVITAKDDNQMHSILNEA----I 215
               |...|.|...|::....||     .|.|.|..|::.:.:...:.|...::...|::.    |
 Worm   836 LKFPDGGALTRPDIHLITKAPY-----PLASVVEKCWVEDPASRPSIKKVRELLKPLSKGLKGNI 895

  Fly   216 YLSCVNLLGIFFRLMRDIALRTTFLDRRQYVEENLLLRYARDQERSLLLSILPAQIADRLQEDVK 280
            ..:.:|||..:...:.|:     ..:|.:.:|:.      |.:..||||.:||..:|:.|:..  
 Worm   896 ADNIMNLLDRYRNNLEDV-----IKERTEQLEDE------RKRNESLLLQLLPKSVANSLKNG-- 947

  Fly   281 NRIERSKQQHQQQSQVDLRRSADSQTLKRWRQPDHGTLFIEPHEDVTVLYADVVNYTHLTTTLDV 345
                                           ||    :..|.::.|::.::|:|.:|.|::....
 Worm   948 -------------------------------QP----VDAEFYDSVSIYFSDIVGFTALSSKSTP 977

  Fly   346 KKLVEALHDLFVRFDIASEEYNVLRIKFLGDCYYCVAGLANPNAD-HAKCCVDLGLRMIKDIRDV 409
            .::|..|::|:..||...::::..:::.:||.|..|:||...|:. ||.......|.::..|:..
 Worm   978 LQVVNMLNNLYTNFDTIIDKFDCYKVETIGDAYMFVSGLPEVNSYLHAGEVASASLELLDSIKTF 1042

  Fly   410 R------EKRHLNIDMRIGVHSGDVLSGVIGAAKWQFDIWSKDVDIANRLEATGATGRVHVSQKT 468
            .      ||    :.:|||.|:|.|::||:|....::.::...|.|||.:|::|...|:.:|...
 Worm  1043 TVSHCPDEK----LRLRIGNHTGPVVTGVVGIRMPRYCLFGDTVIIANMMESSGEPMRIQISSDA 1103

  Fly   469 LSLL--DGEYFFEDGTEKAREDPVLQ-KHGIRTFLIKSLRAPMHDPRRRMRERQVKKLSEASKAN 530
            ..|:  .|.|..|.     ||..||: |..:.|:.       |:|..:..|..::    .|.:..
 Worm  1104 YELILKCGGYVTEQ-----REKIVLKNKLEVMTYW-------MNDYSKDARLARL----VAHQEK 1152

  Fly   531 FMH-NSTLHQYNQ 542
            |.| ...:|::|:
 Worm  1153 FPHLEHLIHKFNK 1165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXDNP_620469.2 AC_N <42..284 CDD:292831 37/197 (19%)
CYCc 254..476 CDD:214485 54/230 (23%)
Nucleotidyl_cyc_III 321..503 CDD:299850 51/191 (27%)
CYCc 856..1117 CDD:214485
Nucleotidyl_cyc_III 878..1142 CDD:299850
gcy-11NP_001359843.1 Periplasmic_Binding_Protein_type1 <234..452 CDD:385651
PKc_like 640..890 CDD:389743 21/123 (17%)
CYCc 923..1116 CDD:214485 55/239 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.