DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXD and Npr3

DIOPT Version :9

Sequence 1:NP_620469.2 Gene:ACXD / 38284 FlyBaseID:FBgn0040507 Length:1162 Species:Drosophila melanogaster
Sequence 2:NP_032754.2 Gene:Npr3 / 18162 MGIID:97373 Length:536 Species:Mus musculus


Alignment Length:337 Identity:62/337 - (18%)
Similarity:102/337 - (30%) Gaps:122/337 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   802 NAKYSHIL-----------LMIITFGIFHLMERQTEFIAKVDYNWKRQLIKKQEDALITNDTIKV 855
            :.:|||:.           :|:..|...|               |.|..:...:|.|..|     
Mouse   163 DTEYSHLTRVAPAYAKMGEMMLALFRHHH---------------WSRAALVYSDDKLERN----- 207

  Fly   856 LLTNILPTHVADFYLSNQLQNELYYEEYDNVAVMFASIKNFDTDKIGLRVLNEIICDFDDVLNKY 920
                        .|.:.:..:|::.||     .:..|..|||..|         ..|.||::...
Mouse   208 ------------CYFTLEGVHEVFQEE-----GLHTSAYNFDETK---------DLDLDDIVRYI 246

  Fly   921 SQSLRVEKIKVANWTYMAACGLDVSR------SEQVNAPQMKFRNVSLMPNGRRSRYDGARSSNA 979
            ..|.||        ..|.|.|..:.|      ...:.:....|.|:.|.           .||: 
Mouse   247 QGSERV--------VIMCASGDTIRRIMLAVHRHGMTSGDYAFFNIELF-----------NSSS- 291

  Fly   980 DGVQRVPYGNGSNIALDLDLERGQYEGNVITSGPRISSTHNGSSSNEVVRVM-------AEFALD 1037
                   ||:||       ..||....         |......||.:.|.::       .:|:::
Mouse   292 -------YGDGS-------WRRGDKHD---------SEAKQAYSSLQTVTLLRTVKPEFEKFSME 333

  Fly  1038 LMRTMRR--FNTENMQTEY-EGSTDYGMLRIGISHGRAMAGVVGISKPHYDIWGNPVNMASRMDS 1099
            :..::.:  .|.|:....: ||..|..:|.:...|....|   |.||..   .|..:........
Mouse   334 VKSSVEKQGLNEEDYVNMFVEGFHDAILLYVLALHEVLRA---GYSKKD---GGKIIQQTWNRTF 392

  Fly  1100 TGVPGQIQVTEN 1111
            .|:.||:.:..|
Mouse   393 EGIAGQVSIDAN 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXDNP_620469.2 AC_N <42..284 CDD:292831
CYCc 254..476 CDD:214485
Nucleotidyl_cyc_III 321..503 CDD:299850
CYCc 856..1117 CDD:214485 51/272 (19%)
Nucleotidyl_cyc_III 878..1142 CDD:299850 49/250 (20%)
Npr3NP_032754.2 PBP1_NPR_C_like 49..440 CDD:107381 62/337 (18%)
ANF_receptor 66..419 CDD:279440 62/337 (18%)
TM_EphA1 471..502 CDD:214014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.