DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXD and odr-1

DIOPT Version :9

Sequence 1:NP_620469.2 Gene:ACXD / 38284 FlyBaseID:FBgn0040507 Length:1162 Species:Drosophila melanogaster
Sequence 2:NP_001362115.1 Gene:odr-1 / 181479 WormBaseID:WBGene00003848 Length:1047 Species:Caenorhabditis elegans


Alignment Length:588 Identity:113/588 - (19%)
Similarity:216/588 - (36%) Gaps:173/588 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DSYFDSAIEYNRSNPISLARTSS--------------QAQTVQNEKNWEWSYLVRKCRNLELEDS 52
            |:.....:|...||..:.|..:|              :|:.||.::       :||....|....
 Worm   470 DAKMQRELENRASNTDNAAALTSRRRVFGSYALVGTQRAEYVQFKQ-------IRKINFPETTLD 527

  Fly    53 YDLYMRRLRVGYLSLFIFIHV-----AVTVIHTLLLLTTPE------------------------ 88
            |...:::|:...|:.|..|.|     .:|::|||:...|.|                        
 Worm   528 YLYSLKQLQHDNLAKFYGIQVNDDIMTMTILHTLVERGTLEEFCLDRDFGMDDTFKSAFMRDILK 592

  Fly    89 -IKYVYVDMVAY-------MCSGLVIWV----VLGV-NFRSELVSKHGWVVYATSWLAVCVMVLM 140
             ::|::...:.|       .|...:.||    :.|| ||.|:.:....  :......|..:....
 Worm   593 GLQYLHKSSIGYHGHLQASTCLIDINWVLKLTLYGVSNFMSDQLDAEN--IKVPEQAAHMITYPQ 655

  Fly   141 DIGLNVYHATSHND-------IL--NPIYDAYTLYAIYMFM---PVPY-LLQPFVLGSAVTFCYI 192
            .:.....|...::|       ::  :|..|.|.:..|:..|   ..|| |:......:|.....|
 Worm   656 YVCFPPEHIREYDDSGKQPPRVVRGSPKGDIYCVGMIFYMMVEREDPYHLIHSVERPNATLIKQI 720

  Fly   193 INYSFVITAKDDNQMHSILNE------------------------AIY-LSCVNLLGIFFR---- 228
            :|.:.:....||.:..::|.|                        .:| ||..||:....|    
 Worm   721 LNENHMPRITDDYRQENMLLEMCKECWDRNPDKRPTIKKLIESISTVYPLSKGNLVDQMIRMSEK 785

  Fly   229 ----LMRDIALRTTFLDRRQYVEENLLLRYARDQERSLLLSILPAQIADRLQEDVKNRIERSKQQ 289
                |.:.:|:||..|...|.            |...||..:|||.||    :|:||        
 Worm   786 YADELEQMVAIRTADLADAQM------------QTMRLLNEMLPASIA----KDLKN-------- 826

  Fly   290 HQQQSQVDLRRSADSQTLKRWRQPDHGTLFIEP--HEDVTVLYADVVNYTHLTTTLDVKKLVEAL 352
                                       .|.:.|  :|..||::..:.::..|......::::..|
 Worm   827 ---------------------------GLIMPPRSYESATVMFVQICDFNALMKRSSPEQVIAFL 864

  Fly   353 HDLFVRFDIASEEYNVLRIKFLGDCYYCVAGLANPNA-----DHAKCCVDLGLRMIKDIRDVREK 412
            :|::.:||...:.::..:::..|:.|...:|:.:.|.     :.|:  :.|.:|.|..|..::..
 Worm   865 NDIYDQFDTVIKRHDAYKVETTGETYMVASGVPHENEGRHIFEVAE--ISLEIREISYIYVLQHD 927

  Fly   413 RHLNIDMRIGVHSGDVLSGVIGAAKWQFDIWSKDVDIANRLEATGATGRVHVSQKTLSLL--DGE 475
            ::..:.:|||.|:|.:.:||||....::.::...|:.|:|:::.....::..|:.|..||  ..|
 Worm   928 KNYKLRIRIGFHAGPIAAGVIGIRSPRYCLFGDTVNFASRMQSNCPPNQIQTSEITARLLFDSHE 992

  Fly   476 YFF 478
            |.|
 Worm   993 YKF 995

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXDNP_620469.2 AC_N <42..284 CDD:292831 66/329 (20%)
CYCc 254..476 CDD:214485 46/230 (20%)
Nucleotidyl_cyc_III 321..503 CDD:299850 37/167 (22%)
CYCc 856..1117 CDD:214485
Nucleotidyl_cyc_III 878..1142 CDD:299850
odr-1NP_001362115.1 Periplasmic_Binding_Protein_type1 63..378 CDD:385651
PK_GC 495..768 CDD:270894 46/281 (16%)
CYCc 803..996 CDD:214485 50/246 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.