DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXD and gcy-8

DIOPT Version :9

Sequence 1:NP_620469.2 Gene:ACXD / 38284 FlyBaseID:FBgn0040507 Length:1162 Species:Drosophila melanogaster
Sequence 2:NP_501324.2 Gene:gcy-8 / 177584 WormBaseID:WBGene00001535 Length:1152 Species:Caenorhabditis elegans


Alignment Length:272 Identity:63/272 - (23%)
Similarity:113/272 - (41%) Gaps:49/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 LNEAIYLSCV-NLLGIFFRLMRDIA--LRTTFLDRRQYVEENLLLRYARDQERSLLLSILPAQIA 272
            ||...||:.. :|:....|:|...|  |.....:|...:||      |..:...||..:|||.:|
 Worm   851 LNVETYLNIKGSLVDQMTRMMEQYANNLEKLVAERTGMLEE------ANQRADRLLSQLLPAYVA 909

  Fly   273 DRLQEDVKNRIERSKQQHQQQSQVDLRRSADSQTLKRWRQPDHGTLFIEPHEDVTVLYADVVNYT 337
            :.|:                     |.|....:|.                ...|||::|:|.:|
 Worm   910 NELK---------------------LGRPVPPKTF----------------TSSTVLFSDIVGFT 937

  Fly   338 HLTTTLDVKKLVEALHDLFVRFDIASEEYNVLRIKFLGDCYYCVAGLANPNAD-HAKCCVDLGLR 401
            .:.......::|..|:.:|..||......:..:::.:||.|..|:|:...|.. |......:.|.
 Worm   938 EMCQNASPLEVVAVLNGIFDGFDQFIARKDAYKVETIGDAYMVVSGVPEENGHRHINEIASIALD 1002

  Fly   402 MIKDIRD--VREKRHLNIDMRIGVHSGDVLSGVIGAAKWQFDIWSKDVDIANRLEATGATGRVHV 464
            :.|.:.:  |..||...:..|:|.|:|.|.:.|:|....::.::...|::|:|:|:....|:..:
 Worm  1003 VHKFLSEFIVPHKRDTKVQCRLGFHTGPVAAAVVGLNAPRYCLFGDTVNMASRMESNSEPGKTQI 1067

  Fly   465 SQKTLSLLDGEY 476
            |:...:||..||
 Worm  1068 SETAKNLLLKEY 1079

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXDNP_620469.2 AC_N <42..284 CDD:292831 20/75 (27%)
CYCc 254..476 CDD:214485 49/224 (22%)
Nucleotidyl_cyc_III 321..503 CDD:299850 40/159 (25%)
CYCc 856..1117 CDD:214485
Nucleotidyl_cyc_III 878..1142 CDD:299850
gcy-8NP_501324.2 ANF_receptor 87..442 CDD:279440
Periplasmic_Binding_Protein_Type_1 94..434 CDD:299141
PKc_like 558..850 CDD:304357
HNOBA <866..912 CDD:285003 14/51 (27%)
CYCc 891..1084 CDD:214485 52/232 (22%)
Guanylate_cyc 918..1105 CDD:278633 41/178 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.