DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXD and Gucy2e

DIOPT Version :9

Sequence 1:NP_620469.2 Gene:ACXD / 38284 FlyBaseID:FBgn0040507 Length:1162 Species:Drosophila melanogaster
Sequence 2:XP_036012232.1 Gene:Gucy2e / 14919 MGIID:105123 Length:1139 Species:Mus musculus


Alignment Length:299 Identity:80/299 - (26%)
Similarity:140/299 - (46%) Gaps:59/299 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 QIADRLQEDVKNRIERSKQQHQQQSQV--DLRRSADSQTLKRWRQPDHGTLFIEPH--EDVTVLY 330
            |.:..|::.::.|.|..:|:.|:..::  .:...:.::.||.      || .:||.  |:||:.:
Mouse   860 QYSSNLEDLIRERTEELEQEKQKTDRLLTQMLPPSVAEALKM------GT-SVEPEYFEEVTLYF 917

  Fly   331 ADVVNYTHLTTTLDVKKLVEALHDLFVRFDIASEEYNVLRIKFLGDCYYCVAGLANPNAD-HAKC 394
            :|:|.:|.::...:..::|:.|:||:..||.....::|.:::.:||.|...:||...|.. ||..
Mouse   918 SDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGAHDVYKVETIGDAYMVASGLPQRNGQRHAAE 982

  Fly   395 CVDLGLRMIKDIRDVREKRHL---NIDMRIGVHSGDVLSGVIGAAKWQFDIWSKDVDIANRLEAT 456
            ..::.|.::..:...| .||:   .:.:|||:|||..::||:|....::.::...|:.|:|:|:|
Mouse   983 IANMSLDILSAVGSFR-MRHMPEVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMEST 1046

  Fly   457 GATGRVHVSQKT---LSLLDGEYFFE--DGTE---KARED-----------------PVLQ---- 492
            |...|:||:..|   |..||..:..|  ..||   |..||                 |.||    
Mouse  1047 GLPYRIHVNMSTVRILRALDQGFQMECRGRTELKGKGIEDTYWLVGRLGFNKPIPKPPDLQPGAS 1111

  Fly   493 KHGIRTFLIKSLRAPMHDPRRRMRERQVKKLSEASKANF 531
            .|||....|        .|.||      |||.:|....|
Mouse  1112 NHGISLQEI--------PPERR------KKLEKARPGQF 1136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXDNP_620469.2 AC_N <42..284 CDD:292831 3/13 (23%)
CYCc 254..476 CDD:214485 59/216 (27%)
Nucleotidyl_cyc_III 321..503 CDD:299850 62/216 (29%)
CYCc 856..1117 CDD:214485
Nucleotidyl_cyc_III 878..1142 CDD:299850
Gucy2eXP_036012232.1 PBP1_sensory_GC_DEF-like 58..465 CDD:380594
PK_GC-2D 570..845 CDD:270945
HNOBA <854..899 CDD:400168 6/38 (16%)
CYCc 879..1070 CDD:214485 54/198 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.