DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXD and Gucy2e

DIOPT Version :9

Sequence 1:NP_620469.2 Gene:ACXD / 38284 FlyBaseID:FBgn0040507 Length:1162 Species:Drosophila melanogaster
Sequence 2:NP_570093.2 Gene:Gucy2e / 113911 RGDID:69322 Length:1123 Species:Rattus norvegicus


Alignment Length:271 Identity:72/271 - (26%)
Similarity:132/271 - (48%) Gaps:39/271 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 IAD---RLQEDVKNRIERSKQQHQQQSQVDLRRSADSQTLKRWRQPD--H----GTLFIEPH--E 324
            :||   |:.|.....:|...|:..:  :::|.|....:.|.:...|.  |    ||. :||.  :
  Rat   829 VADSMLRMLEKYSQSLEGLVQERTE--ELELERRKTERLLSQMLPPSVAHALKMGTT-VEPEYFD 890

  Fly   325 DVTVLYADVVNYTHLTTTLDVKKLVEALHDLFVRFDIASEEYNVLRIKFLGDCYYCVAGLANPNA 389
            .||:.::|:|.:|.::...:..::|..|:||:..||...:.::|.:::.:||.|...:||...|.
  Rat   891 QVTIYFSDIVGFTTISALSEPIEVVGFLNDLYTMFDAVLDSHDVYKVETIGDAYMVASGLPRRNG 955

  Fly   390 D-HAKCCVDLGLRMIKDIRDVREKRH---LNIDMRIGVHSGDVLSGVIGAAKWQFDIWSKDVDIA 450
            : ||....::.|.::....:.| .||   :.|.:|.|:|||..::||:|....::.::...|:.|
  Rat   956 NRHAAEIANMALEILSYAGNFR-MRHAPDVPIRVRAGLHSGPCVAGVVGLTMPRYCLFGDTVNTA 1019

  Fly   451 NRLEATGATGRVHVSQKT---LSLLDGEYFFEDGTEKAREDPVLQKHGI--------RTFLIKSL 504
            :|:|:||...|:|||:.|   |..||..|..:     .|....|:..|:        :|...:||
  Rat  1020 SRMESTGLPYRIHVSRNTVQALLSLDEGYKID-----VRGQTELKGKGLEETYWLTGKTGFCRSL 1079

  Fly   505 RAPMH----DP 511
            ..|:.    ||
  Rat  1080 PTPLSIQPGDP 1090

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXDNP_620469.2 AC_N <42..284 CDD:292831 4/15 (27%)
CYCc 254..476 CDD:214485 62/222 (28%)
Nucleotidyl_cyc_III 321..503 CDD:299850 54/198 (27%)
CYCc 856..1117 CDD:214485
Nucleotidyl_cyc_III 878..1142 CDD:299850
Gucy2eNP_570093.2 PBP1_sensory_GC_DEF-like 71..445 CDD:380594
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 529..556
PK_GC-2D 554..824 CDD:270945
CYCc 861..1050 CDD:214485 55/190 (29%)
Interaction with NCALD. /evidence=ECO:0000269|PubMed:18178149 880..921 11/41 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.