DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXD and gucy1b1

DIOPT Version :9

Sequence 1:NP_620469.2 Gene:ACXD / 38284 FlyBaseID:FBgn0040507 Length:1162 Species:Drosophila melanogaster
Sequence 2:XP_004911214.1 Gene:gucy1b1 / 100379900 XenbaseID:XB-GENE-950986 Length:618 Species:Xenopus tropicalis


Alignment Length:409 Identity:89/409 - (21%)
Similarity:176/409 - (43%) Gaps:109/409 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 VSKHGWVVYATSWLAVCVMVLMDIGLNVYHATSHNDILNPIYDAYTLYAIYMFMP----VPYLLQ 179
            :|.||.:.:..:   |.|:...:..|:|..:.|.:::.........|....:::|    :.:|..
 Frog   263 ISFHGILSHINT---VFVLRSKEGLLDVEKSESEDELTGTEISCLRLKGQMIYLPEADNILFLCS 324

  Fly   180 PFVLGSAVTFCYIINYSFVITAKDDNQMHSILNEAIYLSCVN---------LLGIFFR----LMR 231
            |.|:                      .:..:....:|||.:.         |||..||    |.:
 Frog   325 PSVM----------------------NLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQ 367

  Fly   232 DIALRTTFLDRRQYVEENLLLRYARDQER---SLLLSILPAQIADRLQEDVKNRIERSKQQHQQQ 293
            ::.:.|   ||.|:.     ||...|:::   :||.|:||..:|:.|             :|:: 
 Frog   368 ELEILT---DRLQHT-----LRALEDEKKKTDTLLYSVLPPSVANEL-------------RHKR- 410

  Fly   294 SQVDLRRSADSQTLKRWRQPDHGTLFIEPHEDVTVLYADVVNYT-----HLTTTLDVKKLVEALH 353
             .|..:|                      :::||:|::.:|.:.     |.:.. ...|:|..|:
 Frog   411 -PVPAKR----------------------YDNVTILFSGIVGFNTFCSKHASGE-GAMKIVNLLN 451

  Fly   354 DLFVRFDIASEEYN---VLRIKFLGDCYYCVAGLANPNADHAKCCVDLGLRMIKDIRDVREKRHL 415
            |::.||||.::..|   |.:::.:||.|..|:|:..|...||:....|.|.|::....|:.... 
 Frog   452 DIYTRFDILTDSRNNPYVYKVETVGDKYMTVSGIPEPCVHHARSICHLALDMMEIAGQVQVDGE- 515

  Fly   416 NIDMRIGVHSGDVLSGVIGAAKWQFDIWSKDVDIANRLEATGATGRVHVSQKTLSLL------DG 474
            ::.:.||:|:|:|::||||....::.::...|::.:|.|.||..|:::||:.|...|      |.
 Frog   516 SVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDP 580

  Fly   475 EYFFE---DGTEKAREDPV 490
            ::..:   ..:.|.:.||:
 Frog   581 QFHLQYRGPVSMKGKTDPM 599

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXDNP_620469.2 AC_N <42..284 CDD:292831 36/184 (20%)
CYCc 254..476 CDD:214485 58/238 (24%)
Nucleotidyl_cyc_III 321..503 CDD:299850 50/187 (27%)
CYCc 856..1117 CDD:214485
Nucleotidyl_cyc_III 878..1142 CDD:299850
gucy1b1XP_004911214.1 HNOB 2..166 CDD:377902
HNOBA 207..406 CDD:369471 35/175 (20%)
Guanylate_cyc 412..605 CDD:306677 52/212 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.