DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXD and LOC100333871

DIOPT Version :9

Sequence 1:NP_620469.2 Gene:ACXD / 38284 FlyBaseID:FBgn0040507 Length:1162 Species:Drosophila melanogaster
Sequence 2:XP_002666572.2 Gene:LOC100333871 / 100333871 -ID:- Length:243 Species:Danio rerio


Alignment Length:252 Identity:57/252 - (22%)
Similarity:107/252 - (42%) Gaps:61/252 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 ILPAQIADRLQEDVKNRIERSKQQHQQQSQVDLRRSADSQTLKRWRQPDHGTLFIEPHEDVTVLY 330
            :||.|:||.|         |..:..|.||.|                            ..||.:
Zfish     1 MLPKQVADDL---------RLGKPMQAQSYV----------------------------SATVFF 28

  Fly   331 ADVVNYTHLTTTLDVKKLVEALHDLFVRFDIASEEYNVLRIKFLGDCYYCVAGLANPNAD-HAKC 394
            :|:|.:|.|::|....::|:.|:.|:..||...:.::|.:::.:||.|..|:|:...|.. ||..
Zfish    29 SDIVGFTQLSSTSTPYQVVDFLNKLYTTFDEIIDNHDVYKVETIGDAYMVVSGVPRENGILHASE 93

  Fly   395 CVDLGLRMIKDIRDVR--EKRHLNIDMRIGVHSGDVLSGVIGAAKWQFDIWSKDVDIANRLEATG 457
            ..::.|.::...:..|  .:....:.:|.|:|||.|::||:|....::.::...|:.|:|:|:|.
Zfish    94 IANMALDLVSVCKTFRIPHRPQTQLQIRAGIHSGPVVAGVVGTKMPRYCLFGDTVNTASRMESTS 158

  Fly   458 ATGRVHVSQKTLSLLD------------------GE---YFFEDGTEKAREDPVLQK 493
            ...::..|.....||:                  |:   |:.|....|..:.|..|:
Zfish   159 EALKIQCSSSAFYLLEEIGGYLLTCRGLLQVKGKGDMVTYWLEGKCSKDMKKPATQQ 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXDNP_620469.2 AC_N <42..284 CDD:292831 6/17 (35%)
CYCc 254..476 CDD:214485 52/233 (22%)
Nucleotidyl_cyc_III 321..503 CDD:299850 46/197 (23%)
CYCc 856..1117 CDD:214485
Nucleotidyl_cyc_III 878..1142 CDD:299850
LOC100333871XP_002666572.2 CYCc 1..179 CDD:214485 51/214 (24%)
Guanylate_cyc 16..202 CDD:278633 46/213 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.